prot_P-wetherbeei_contig934.5.2 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig934.5.2 vs. uniprot
Match: A0A835Z765_9STRA (Mitochondrial import inner membrane translocase subunit TIM22 n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z765_9STRA) HSP 1 Score: 80.5 bits (197), Expect = 6.860e-14 Identity = 50/119 (42.02%), Postives = 67/119 (56.30%), Query Frame = 0 Query: 132 AAVRPSPAAFVQSAQRSASGVAENMLEVGLSTAGGFLNGGVLGYFFG----------FLGGVRNNPNAGFAFLRAMHSKALGSAASWGGVCASFSGIGTATRVLRGKEDRWNHIIASCG 240 AAV P ++ RS SG E +EVGL+T G ++GGVLGY G F GG+ N ++AMH+K + +SWG + A FSG +A RV+RG+ED WN I+ SCG Sbjct: 78 AAVAPLTTIAKTASGRSESGFFECCMEVGLTTVGSLVSGGVLGYIIGWGIGIAQKGAFEGGLGNA-------IKAMHAKGRQTGSSWGLITACFSGFTSAARVMRGREDHWNSILGSCG 189
BLAST of mRNA_P-wetherbeei_contig934.5.2 vs. uniprot
Match: A0A7S3Q6B1_9STRA (Hypothetical protein n=4 Tax=Chaetoceros debilis TaxID=122233 RepID=A0A7S3Q6B1_9STRA) HSP 1 Score: 54.7 bits (130), Expect = 9.380e-5 Identity = 39/108 (36.11%), Postives = 54/108 (50.00%), Query Frame = 0 Query: 155 NMLEVGLSTAGGFLNGGVLGYFFGFLGGV----RN---------------NPNAGFAFLR----AMHSKALGSAASWGGVCASFSGIGTATRVLRGK-EDRWNHIIAS 238 N +EVG++TAG +++GG+ GY G + GV +N N G + ++ + +S A SWG V ASFSG TR RG EDRWN I+ S Sbjct: 215 NSVEVGVTTAGSYMSGGLFGYLIGGVSGVPALFKNSAETATSTATQNASANARGGLSEIQRRVGSWNSHAFARGKSWGEVSASFSGFHALTRAARGGVEDRWNGIVGS 322 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig934.5.2 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig934.5.2 ID=prot_P-wetherbeei_contig934.5.2|Name=mRNA_P-wetherbeei_contig934.5.2|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=315bpback to top |