prot_P-wetherbeei_contig931.4.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig931.4.1 vs. uniprot
Match: D8LDC0_ECTSI (RING-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDC0_ECTSI) HSP 1 Score: 85.1 bits (209), Expect = 2.450e-17 Identity = 41/95 (43.16%), Postives = 59/95 (62.11%), Query Frame = 0 Query: 6 EEAAAGAPVPLVQRCNLCWNG--VCL---SGSGQCFRTTCRHIFCESCAYNHFGEHQTCPSCGRELRETDVCEVSFGLPPSQDFTSSLYQELYKE 95 +E A G +P RCN+CWN V L G+G C+ T C H+FCESCA+ HFG+ Q CP+CG L E+++ +++ GL PS +++E KE Sbjct: 3 QEGAPGQTLP--HRCNMCWNPHPVALPRQEGTGSCYVTRCGHLFCESCAFRHFGQSQACPTCGHGLDESEIQDLTLGLEPSS-LRRIVFEEALKE 94
BLAST of mRNA_P-wetherbeei_contig931.4.1 vs. uniprot
Match: A0A6H5JFE1_9PHAE (RING-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFE1_9PHAE) HSP 1 Score: 84.7 bits (208), Expect = 3.570e-17 Identity = 35/76 (46.05%), Postives = 50/76 (65.79%), Query Frame = 0 Query: 6 EEAAAGAPVPLVQRCNLCWNGVCLSGSGQCFRTTCRHIFCESCAYNHFGEHQTCPSCGRELRETDVCEVSFGLPPS 81 +E G +P RCN+CWN G+G C+ T C H+FCESCA+ HFG+ Q CP+CG L E+++ +++ GL PS Sbjct: 3 QEGTPGHSLP--HRCNMCWN----EGNGSCYVTRCGHLFCESCAFRHFGQSQACPTCGHGLDESEIQDLTLGLEPS 72
BLAST of mRNA_P-wetherbeei_contig931.4.1 vs. uniprot
Match: G4YY62_PHYSP (RING-type domain-containing protein n=1 Tax=Phytophthora sojae (strain P6497) TaxID=1094619 RepID=G4YY62_PHYSP) HSP 1 Score: 58.9 bits (141), Expect = 3.650e-9 Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 0 Query: 19 RCNLCWNGVC--LSGSGQCFRTTCRHIFCESCAYNHFGEHQT-CPSCGRELRE 68 RCN CW + + C+RTTC H+FCE CAY HFG+ + CP+C +L + Sbjct: 47 RCNSCWEPILPDAQSAETCYRTTCGHLFCEKCAYKHFGQGRLQCPACSADLSQ 99
BLAST of mRNA_P-wetherbeei_contig931.4.1 vs. uniprot
Match: F0WGR8_9STRA (AlNc14C94G5795 protein n=1 Tax=Albugo laibachii Nc14 TaxID=890382 RepID=F0WGR8_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 5.680e-9 Identity = 25/60 (41.67%), Postives = 34/60 (56.67%), Query Frame = 0 Query: 19 RCNLCWNGVCLS--GSGQCFRTTCRHIFCESCAYNHFGEHQ-TCPSCGRELRETDVCEVS 75 RCN CW + S + C+RT C H+FCE CAY HFG Q CP+C ++ + E + Sbjct: 47 RCNACWERILSSTHSAQTCYRTYCSHLFCEKCAYKHFGGGQLVCPACHSDMSRNGINETT 106
BLAST of mRNA_P-wetherbeei_contig931.4.1 vs. uniprot
Match: A0A329S1I8_9STRA (RING-type domain-containing protein n=2 Tax=Phytophthora TaxID=4783 RepID=A0A329S1I8_9STRA) HSP 1 Score: 57.0 bits (136), Expect = 2.060e-8 Identity = 23/53 (43.40%), Postives = 33/53 (62.26%), Query Frame = 0 Query: 19 RCNLCWNGVC--LSGSGQCFRTTCRHIFCESCAYNHFGEHQT-CPSCGRELRE 68 RCN CW + + C+RT+C H+FCE CAY HFG+ + CP+C +L + Sbjct: 47 RCNACWEPILPDAQSAETCYRTSCGHLFCEKCAYKHFGQGRLQCPACNIDLSQ 99
BLAST of mRNA_P-wetherbeei_contig931.4.1 vs. uniprot
Match: H3GLD4_PHYRM (RING-type domain-containing protein n=1 Tax=Phytophthora ramorum TaxID=164328 RepID=H3GLD4_PHYRM) HSP 1 Score: 57.0 bits (136), Expect = 2.060e-8 Identity = 23/53 (43.40%), Postives = 33/53 (62.26%), Query Frame = 0 Query: 19 RCNLCWNGVC--LSGSGQCFRTTCRHIFCESCAYNHFGEHQT-CPSCGRELRE 68 RCN CW + + C+RT+C H+FCE CAY HFG+ + CP+C +L + Sbjct: 47 RCNACWGPILPDAQSAETCYRTSCGHLFCEKCAYKHFGQGRLQCPACNVDLSQ 99
BLAST of mRNA_P-wetherbeei_contig931.4.1 vs. uniprot
Match: W2QZI3_PHYPN (RING-type domain-containing protein n=6 Tax=Phytophthora parasitica TaxID=4792 RepID=W2QZI3_PHYPN) HSP 1 Score: 57.4 bits (137), Expect = 2.070e-8 Identity = 23/53 (43.40%), Postives = 33/53 (62.26%), Query Frame = 0 Query: 19 RCNLCWNGVC--LSGSGQCFRTTCRHIFCESCAYNHFGEHQT-CPSCGRELRE 68 RCN CW + + C+RT+C H+FCE CAY HFG+ + CP+C +L + Sbjct: 44 RCNACWEPILPDAQSAETCYRTSCGHLFCEKCAYKHFGQGRLQCPTCSVDLNQ 96
BLAST of mRNA_P-wetherbeei_contig931.4.1 vs. uniprot
Match: A0A833WTW3_PHYIN (Zinc-RING finger domain n=1 Tax=Phytophthora infestans TaxID=4787 RepID=A0A833WTW3_PHYIN) HSP 1 Score: 58.9 bits (141), Expect = 4.980e-8 Identity = 27/79 (34.18%), Postives = 43/79 (54.43%), Query Frame = 0 Query: 19 RCNLCWNGVC--LSGSGQCFRTTCRHIFCESCAYNHFGEHQT-CPSCGRELRET--DVCEVSFGLPPSQDFTSSLYQEL 92 RCN CW + + + C+RT+C H+FCE CAY HFG+ + CP C +L E + E + T ++++E+ Sbjct: 47 RCNACWEPILPDVQSAETCYRTSCGHLFCEKCAYKHFGQGRLQCPVCSIDLNEARGGISETTIHGVADSKRTEAIWEEM 125
BLAST of mRNA_P-wetherbeei_contig931.4.1 vs. uniprot
Match: A0A225V855_9STRA (Zinc ion binding protein n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225V855_9STRA) HSP 1 Score: 55.1 bits (131), Expect = 9.020e-8 Identity = 22/47 (46.81%), Postives = 30/47 (63.83%), Query Frame = 0 Query: 19 RCNLCWNGVC--LSGSGQCFRTTCRHIFCESCAYNHFGEHQT-CPSC 62 RCN CW + + C+RT+C H+FCE CAY HFG+ + CP+C Sbjct: 47 RCNACWEPILPDAQSAETCYRTSCGHLFCEKCAYKHFGQGRLQCPAC 93
BLAST of mRNA_P-wetherbeei_contig931.4.1 vs. uniprot
Match: A0A2P4XRP0_9STRA (Zinc ion binding protein n=1 Tax=Phytophthora palmivora var. palmivora TaxID=611791 RepID=A0A2P4XRP0_9STRA) HSP 1 Score: 55.1 bits (131), Expect = 9.660e-8 Identity = 22/47 (46.81%), Postives = 30/47 (63.83%), Query Frame = 0 Query: 19 RCNLCWNGVC--LSGSGQCFRTTCRHIFCESCAYNHFGEHQT-CPSC 62 RCN CW + + C+RT+C H+FCE CAY HFG+ + CP+C Sbjct: 47 RCNACWEPILPDAQSAETCYRTSCGHLFCEKCAYKHFGQGRLQCPAC 93 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig931.4.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 14
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig931.4.1 ID=prot_P-wetherbeei_contig931.4.1|Name=mRNA_P-wetherbeei_contig931.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=99bpback to top |