prot_P-wetherbeei_contig927.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig927.1.1 vs. uniprot
Match: F0Y2V3_AURAN (Helicase C-terminal domain-containing protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0Y2V3_AURAN) HSP 1 Score: 63.9 bits (154), Expect = 8.730e-7 Identity = 38/87 (43.68%), Postives = 49/87 (56.32%), Query Frame = 0 Query: 2 SFKVRVAIPNWHCASLSDRAG-------KIFMPRNSLAAAAVHQRAKER---VFGVASNMLDLQSGGARAEGITLLPPGDDWLALAL 78 + K+ V P W AG ++ P +SLAA AVH A +R V+ VA M+D GGARAE +T+LPPGD+WL LAL Sbjct: 711 AVKLDVPKPAWKLVFAPASAGASAPPSAQVLTPFHSLAAVAVHHAADDRDATVYAVAGAMVDTAGGGARAESVTVLPPGDEWLGLAL 797
BLAST of mRNA_P-wetherbeei_contig927.1.1 vs. uniprot
Match: A0A8J2X0N8_9STRA (Hypothetical protein n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A8J2X0N8_9STRA) HSP 1 Score: 60.1 bits (144), Expect = 1.470e-5 Identity = 31/60 (51.67%), Postives = 41/60 (68.33%), Query Frame = 0 Query: 21 AGKIFMPRNSLAAAAVHQRAKER--VFGVASNMLDLQSGGARAEGITLLPPGDDWLALAL 78 + ++ MP +SL+A AVH + V+ VA MLD GGARAE +TLLPPG++WLAL L Sbjct: 1008 SAQVLMPFHSLSAVAVHHSTTKDQVVYAVAGTMLDTAGGGARAEQLTLLPPGEEWLALCL 1067 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig927.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig927.1.1 ID=prot_P-wetherbeei_contig927.1.1|Name=mRNA_P-wetherbeei_contig927.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=670bpback to top |