prot_P-wetherbeei_contig9147.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9147.1.1 vs. uniprot
Match: A0A7S1TZ75_9STRA (Hypothetical protein (Fragment) n=1 Tax=Phaeomonas parva TaxID=124430 RepID=A0A7S1TZ75_9STRA) HSP 1 Score: 98.6 bits (244), Expect = 5.790e-22 Identity = 43/81 (53.09%), Postives = 56/81 (69.14%), Query Frame = 0 Query: 4 LWLLLRHPRLWRRWHALSQHVTFHELRVSFLADNDLPANFSFATYLKKCKQHVELQLVEISEAAWLAIAWLVAADLYIKGL 84 LW L HP W + L +HV FHELR F+ N +P NF+FA YLKKCKQHV L+LVE+ AW+ IAWL++ +LY +G+ Sbjct: 171 LWRFLAHPVSWMNYKRLLEHVRFHELRQHFIRANHMPGNFAFAGYLKKCKQHVMLELVEVRSGAWVLIAWLLSINLYAEGI 251 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9147.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9147.1.1 ID=prot_P-wetherbeei_contig9147.1.1|Name=mRNA_P-wetherbeei_contig9147.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=96bpback to top |