prot_P-wetherbeei_contig912.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig912.2.1 vs. uniprot
Match: A0A6A3QK27_9STRA (DDE Tnp4 domain-containing protein n=2 Tax=Phytophthora fragariae TaxID=53985 RepID=A0A6A3QK27_9STRA) HSP 1 Score: 57.0 bits (136), Expect = 1.670e-5 Identity = 37/87 (42.53%), Postives = 49/87 (56.32%), Query Frame = 0 Query: 30 ITPETQLAIAIRYFAAGSVTDIRQKHGVSPAATYECIHRVTKAINRCEEL--AFPGIPTSEEDCAAAAAGFVMKTNSAVFTKCVGAV 114 I+ + L + +RYFA GS+ DIR+ GVS A+ Y + V AIN EL FP PT+ E A+AA F + VF+ CVG V Sbjct: 81 ISVDNALQLTLRYFAGGSMHDIRRVAGVSKASFYRILWLVVDAINAVSELRLVFPRSPTARE---ASAAAFKTLSAEGVFSGCVGCV 164 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig912.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig912.2.1 ID=prot_P-wetherbeei_contig912.2.1|Name=mRNA_P-wetherbeei_contig912.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=315bpback to top |