prot_P-wetherbeei_contig904.7.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig904.7.1 vs. uniprot
Match: A0A5J4YR17_PORPP (Uncharacterized protein n=1 Tax=Porphyridium purpureum TaxID=35688 RepID=A0A5J4YR17_PORPP) HSP 1 Score: 77.0 bits (188), Expect = 2.020e-12 Identity = 31/77 (40.26%), Postives = 47/77 (61.04%), Query Frame = 0 Query: 20 LLDARLNTTVVDISAHAYEQWYHSQKLVMLDCWLHNLALGAEWVLFLDFDEILTWPYEGRSWKEVFPADIPAVTFAT 96 + DA + V+ + + YH Q+L LDCWL L L +EW LF+D DE+LTWP++G +W E+F A++F + Sbjct: 340 IADADPDLQVIFLDRWNRKSHYHGQRLAQLDCWLRALQLNSEWTLFVDLDEVLTWPFQGMTWSEIFGESTQALSFGS 416
BLAST of mRNA_P-wetherbeei_contig904.7.1 vs. uniprot
Match: A0A5J4YSJ1_PORPP (Uncharacterized protein n=1 Tax=Porphyridium purpureum TaxID=35688 RepID=A0A5J4YSJ1_PORPP) HSP 1 Score: 75.5 bits (184), Expect = 6.500e-12 Identity = 30/56 (53.57%), Postives = 39/56 (69.64%), Query Frame = 0 Query: 41 YHSQKLVMLDCWLHNLALGAEWVLFLDFDEILTWPYEGRSWKEVFPADIPAVTFAT 96 YH Q+L LDCWL + L +EWVLF+D DE+LTWP+E SW EVF A++F + Sbjct: 298 YHGQRLAQLDCWLKAMHLNSEWVLFVDLDEVLTWPFEDMSWNEVFGHFAQAISFGS 353 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig904.7.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig904.7.1 ID=prot_P-wetherbeei_contig904.7.1|Name=mRNA_P-wetherbeei_contig904.7.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=253bpback to top |