prot_P-wetherbeei_contig12696.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12696.1.1 vs. uniprot
Match: A0A2M3ZM75_9DIPT (Putative secreted peptide n=1 Tax=Anopheles braziliensis TaxID=58242 RepID=A0A2M3ZM75_9DIPT) HSP 1 Score: 60.5 bits (145), Expect = 1.540e-10 Identity = 29/44 (65.91%), Postives = 34/44 (77.27%), Query Frame = 0 Query: 1 FFFFSWLSTLGVWPLTLPARASEPCTLPMAQRSHTTSEGKGCSL 44 FFFFS+ ST GVWP TLPARASEPCTLP + + T+S G+ SL Sbjct: 10 FFFFSFFSTFGVWPFTLPARASEPCTLPPSSPTVTSSSGELSSL 53
BLAST of mRNA_P-wetherbeei_contig12696.1.1 vs. uniprot
Match: U6BZY7_CONMR (Mr_precursor_154 n=2 Tax=Conus marmoreus TaxID=42752 RepID=U6BZY7_CONMR) HSP 1 Score: 58.2 bits (139), Expect = 7.730e-10 Identity = 28/37 (75.68%), Postives = 31/37 (83.78%), Query Frame = 0 Query: 1 FFFFSWLSTLGVWPLTLPARASEPCTLPMAQRSHTTS 37 FFFFS STLGVWPLTLPARA EPCTLP +R+ T+S Sbjct: 10 FFFFSCGSTLGVWPLTLPARAREPCTLPPTRRTSTSS 46 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12696.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig12696.1.1 ID=prot_P-wetherbeei_contig12696.1.1|Name=mRNA_P-wetherbeei_contig12696.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=44bpback to top |