prot_P-wetherbeei_contig12234.3.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12234.3.1 vs. uniprot
Match: A0A7X9AGD2_9BURK (Uncharacterized protein n=1 Tax=Burkholderiales bacterium TaxID=1891238 RepID=A0A7X9AGD2_9BURK) HSP 1 Score: 121 bits (304), Expect = 3.480e-34 Identity = 49/72 (68.06%), Postives = 64/72 (88.89%), Query Frame = 0 Query: 3 LKQKALEPHLRHCQILDKEVSILIEYPDYKNPNYKGPEGAIYCENIINCYQNNIKCRYSGISPLYPDPFLPK 74 L+QKALEP ++HC +L +V++L+EYPDYK P++KGPEGAIYCENI+ CYQ + +CRYSGISPL+PDPFLP+ Sbjct: 23 LRQKALEPQVKHCYLLGIDVTVLVEYPDYKGPHHKGPEGAIYCENIVPCYQVDRRCRYSGISPLFPDPFLPR 94
BLAST of mRNA_P-wetherbeei_contig12234.3.1 vs. uniprot
Match: A0A355TUT7_9BACT (Uncharacterized protein n=1 Tax=bacterium UBP9_UBA11836 TaxID=2060920 RepID=A0A355TUT7_9BACT) HSP 1 Score: 104 bits (260), Expect = 1.340e-27 Identity = 43/74 (58.11%), Postives = 57/74 (77.03%), Query Frame = 0 Query: 1 PALKQKALEPHLRHCQILDKEVSILIEYPDYKNPNYKGPEGAIYCENIINCYQNNIKCRYSGISPLYPDPFLPK 74 P ++ A+EP R+C IL+KE+++ I YPDY + KGPEG IYCENII CY+ +KCR+SGIS LYPDPF+P+ Sbjct: 27 PMARRCAIEPARRYCYILNKEITVCINYPDYIDSRRKGPEGEIYCENIIECYRKGVKCRHSGISQLYPDPFVPQ 100
BLAST of mRNA_P-wetherbeei_contig12234.3.1 vs. uniprot
Match: A0A7C5RIE0_9FIRM (Uncharacterized protein n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A7C5RIE0_9FIRM) HSP 1 Score: 90.1 bits (222), Expect = 9.780e-22 Identity = 39/68 (57.35%), Postives = 49/68 (72.06%), Query Frame = 0 Query: 4 KQKALEPHLRHCQILDKEVSILIEYPDYKNPNYKGPEGAIYCENIINCYQNNIKCRYSGISPLYPDPF 71 KQKALEP C+IL K+V+IL+EY DYK + G I+C N++ CYQN IKC+YSGIS +PDPF Sbjct: 17 KQKALEPKQLLCKILQKKVTILVEYLDYKGKYHPSEIGEIFCSNMLQCYQNKIKCKYSGISKFFPDPF 84
BLAST of mRNA_P-wetherbeei_contig12234.3.1 vs. uniprot
Match: A0A7C6DS12_9BACT (Uncharacterized protein n=1 Tax=bacterium TaxID=1869227 RepID=A0A7C6DS12_9BACT) HSP 1 Score: 88.6 bits (218), Expect = 4.180e-21 Identity = 37/68 (54.41%), Postives = 50/68 (73.53%), Query Frame = 0 Query: 4 KQKALEPHLRHCQILDKEVSILIEYPDYKNPNYKGPEGAIYCENIINCYQNNIKCRYSGISPLYPDPF 71 KQ+ALEP C+IL K+V ++IE+ DYK + +G I+C N++ CYQNNIKC+YSGIS +PDPF Sbjct: 17 KQRALEPQELFCKILQKKVIVVIEHLDYKGVYHPSVKGEIFCSNMLECYQNNIKCKYSGISKFFPDPF 84
BLAST of mRNA_P-wetherbeei_contig12234.3.1 vs. uniprot
Match: A0A7C2MUI4_9BACT (Uncharacterized protein n=1 Tax=bacterium TaxID=1869227 RepID=A0A7C2MUI4_9BACT) HSP 1 Score: 82.0 bits (201), Expect = 3.240e-18 Identity = 36/67 (53.73%), Postives = 47/67 (70.15%), Query Frame = 0 Query: 4 KQKALEPHLRHCQILDKEVSILIEYPDYKNPNYKGPEGAIYCENIINCYQNNIKCRYSGISPLYPDP 70 K KALEP C+IL+K+++I+IE+ DYK K G I+C N++ CY NIKC+YSGIS YPDP Sbjct: 18 KYKALEPKEVFCKILNKKITIVIEHIDYKGTYTKSDIGEIFCGNMLECYYENIKCKYSGISKFYPDP 84 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12234.3.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig12234.3.1 ID=prot_P-wetherbeei_contig12234.3.1|Name=mRNA_P-wetherbeei_contig12234.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=74bpback to top |