prot_P-wetherbeei_contig1192.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1192.1.1 vs. uniprot
Match: UPI00041B7D31 (cupin domain-containing protein n=2 Tax=Aliagarivorans TaxID=882379 RepID=UPI00041B7D31) HSP 1 Score: 58.5 bits (140), Expect = 7.900e-10 Identity = 24/41 (58.54%), Postives = 32/41 (78.05%), Query Frame = 0 Query: 15 VEKSFKERGYSFGVFEDPQGREWRDFTHGGNELVVVKEGRM 55 +EK F +RGYSFG+FEDP G++W DF H +EL+VV EG + Sbjct: 12 LEKEFLQRGYSFGIFEDPPGQQWLDFVHSVDELLVVLEGDL 52
BLAST of mRNA_P-wetherbeei_contig1192.1.1 vs. uniprot
Match: A0A520PF18_9PROT (Cupin domain-containing protein n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A520PF18_9PROT) HSP 1 Score: 55.8 bits (133), Expect = 7.720e-9 Identity = 21/45 (46.67%), Postives = 34/45 (75.56%), Query Frame = 0 Query: 11 DEKQVEKSFKERGYSFGVFEDPQGREWRDFTHGGNELVVVKEGRM 55 D K++ + ++ RG+SFG+F DP GR W+DF+H ELV++ EG++ Sbjct: 2 DAKKIRQQWESRGFSFGIFRDPPGRVWQDFSHSTEELVILAEGQI 46
BLAST of mRNA_P-wetherbeei_contig1192.1.1 vs. uniprot
Match: E1Z423_CHLVA (Cupin_2 domain-containing protein n=1 Tax=Chlorella variabilis TaxID=554065 RepID=E1Z423_CHLVA) HSP 1 Score: 52.0 bits (123), Expect = 3.440e-7 Identity = 23/41 (56.10%), Postives = 30/41 (73.17%), Query Frame = 0 Query: 15 VEKSFKERGYSFGVFEDPQGREWRDFTHGGNELVVVKEGRM 55 VE+ ++ RGY+ +F DP G+EW DFTH +ELVVV GRM Sbjct: 22 VERDWRPRGYTCDLFVDPPGKEWVDFTHKEDELVVVVTGRM 62
BLAST of mRNA_P-wetherbeei_contig1192.1.1 vs. uniprot
Match: A0A5J4E495_9BACT (Cupin_2 domain-containing protein n=1 Tax=bacterium MnTg03 TaxID=2080453 RepID=A0A5J4E495_9BACT) HSP 1 Score: 51.6 bits (122), Expect = 5.410e-7 Identity = 21/47 (44.68%), Postives = 32/47 (68.09%), Query Frame = 0 Query: 9 PSDEKQVEKSFKERGYSFGVFEDPQGREWRDFTHGGNELVVVKEGRM 55 P D VE ++ G+SFG+F DP G+EW +F+H +E V+V EG++ Sbjct: 13 PVDFSSVEADWQREGFSFGIFRDPPGQEWNNFSHQTDEYVLVAEGQL 59
BLAST of mRNA_P-wetherbeei_contig1192.1.1 vs. uniprot
Match: A0A533ZF65_9BACT (Cupin domain-containing protein n=1 Tax=Nitrospirae bacterium TaxID=2026887 RepID=A0A533ZF65_9BACT) HSP 1 Score: 50.8 bits (120), Expect = 7.360e-7 Identity = 21/45 (46.67%), Postives = 33/45 (73.33%), Query Frame = 0 Query: 11 DEKQVEKSFKERGYSFGVFEDPQGREWRDFTHGGNELVVVKEGRM 55 D+ QVEK ++ RG+S G++ DP G+ W D+TH +EL++V EG + Sbjct: 4 DQTQVEKDWQARGFSCGLWVDPPGQVWEDYTHSTDELLMVLEGEL 48
BLAST of mRNA_P-wetherbeei_contig1192.1.1 vs. uniprot
Match: A0A383DTU3_9ZZZZ (Cupin_2 domain-containing protein n=3 Tax=root TaxID=1 RepID=A0A383DTU3_9ZZZZ) HSP 1 Score: 50.8 bits (120), Expect = 7.870e-7 Identity = 21/41 (51.22%), Postives = 30/41 (73.17%), Query Frame = 0 Query: 15 VEKSFKERGYSFGVFEDPQGREWRDFTHGGNELVVVKEGRM 55 V K +++RG+S ++EDP GREW DF H +ELV+V EG + Sbjct: 11 VRKDWEDRGFSCELWEDPPGREWNDFVHSTDELVMVIEGNL 51
BLAST of mRNA_P-wetherbeei_contig1192.1.1 vs. uniprot
Match: K9TA35_9CYAN (Cupin domain-containing protein n=3 Tax=Pleurocapsales TaxID=52604 RepID=K9TA35_9CYAN) HSP 1 Score: 49.7 bits (117), Expect = 2.140e-6 Identity = 18/42 (42.86%), Postives = 34/42 (80.95%), Query Frame = 0 Query: 14 QVEKSFKERGYSFGVFEDPQGREWRDFTHGGNELVVVKEGRM 55 ++++++++RG+SFGV+ DP G+ W D+TH +ELV++ EG + Sbjct: 5 EIKQNWEKRGFSFGVWSDPPGQIWADYTHDTDELVMLAEGEI 46
BLAST of mRNA_P-wetherbeei_contig1192.1.1 vs. uniprot
Match: A0A2D4RW48_9DELT (Cupin domain-containing protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2D4RW48_9DELT) HSP 1 Score: 49.3 bits (116), Expect = 2.660e-6 Identity = 18/41 (43.90%), Postives = 30/41 (73.17%), Query Frame = 0 Query: 15 VEKSFKERGYSFGVFEDPQGREWRDFTHGGNELVVVKEGRM 55 + + +K + +SFG+F DP GR W DF+H +ELV++ EG++ Sbjct: 6 IRQQWKSKCFSFGIFRDPPGRVWLDFSHSTDELVILAEGQI 46
BLAST of mRNA_P-wetherbeei_contig1192.1.1 vs. uniprot
Match: A0A3D0I9Y9_9DELT (Cupin domain-containing protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A3D0I9Y9_9DELT) HSP 1 Score: 47.4 bits (111), Expect = 1.620e-5 Identity = 18/41 (43.90%), Postives = 31/41 (75.61%), Query Frame = 0 Query: 15 VEKSFKERGYSFGVFEDPQGREWRDFTHGGNELVVVKEGRM 55 +E+S++ERG+S G++ DP G+ W D+ H +ELV+V +G + Sbjct: 6 IERSWRERGFSCGLWIDPPGQVWEDYVHDVDELVMVMDGEV 46
BLAST of mRNA_P-wetherbeei_contig1192.1.1 vs. uniprot
Match: UPI00040698C0 (cupin domain-containing protein n=1 Tax=Thermithiobacillus tepidarius TaxID=929 RepID=UPI00040698C0) HSP 1 Score: 46.2 bits (108), Expect = 4.600e-5 Identity = 17/41 (41.46%), Postives = 30/41 (73.17%), Query Frame = 0 Query: 15 VEKSFKERGYSFGVFEDPQGREWRDFTHGGNELVVVKEGRM 55 +++ + RG+S G++ DP G+ WRD+TH +EL++V EG + Sbjct: 6 IQQDWARRGFSCGLWIDPPGQVWRDYTHPADELLMVMEGEL 46 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1192.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 10
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig1192.1.1 ID=prot_P-wetherbeei_contig1192.1.1|Name=mRNA_P-wetherbeei_contig1192.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=55bpback to top |