prot_P-wetherbeei_contig11311.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: W2PX75_PHYPN (Uncharacterized protein n=1 Tax=Phytophthora parasitica (strain INRA-310) TaxID=761204 RepID=W2PX75_PHYPN) HSP 1 Score: 53.5 bits (127), Expect = 1.100e-6 Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 0 Query: 17 QVSCTVTFDPATEGASLSHALDYFQYQVR 45 QVSCTVTFDP TEG+ L+H LDYFQYQ++ Sbjct: 48 QVSCTVTFDPKTEGSQLAHMLDYFQYQLK 76
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: A0A6H5KM58_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KM58_9PHAE) HSP 1 Score: 55.1 bits (131), Expect = 1.560e-6 Identity = 23/30 (76.67%), Postives = 27/30 (90.00%), Query Frame = 0 Query: 16 VQVSCTVTFDPATEGASLSHALDYFQYQVR 45 VQVSCT+TFDP TEG L+HALDYFQYQ++ Sbjct: 526 VQVSCTITFDPDTEGKHLAHALDYFQYQLK 555
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: A0A1Y1Z8W3_9FUNG (Ribonucleoside-triphosphate reductase (thioredoxin) n=2 Tax=Basidiobolus meristosporus CBS 931.73 TaxID=1314790 RepID=A0A1Y1Z8W3_9FUNG) HSP 1 Score: 53.9 bits (128), Expect = 4.000e-6 Identity = 24/41 (58.54%), Postives = 30/41 (73.17%), Query Frame = 0 Query: 5 LTLYIPLWCGVVQVSCTVTFDPATEGASLSHALDYFQYQVR 45 LT ++ + QVSCTVTFDP TEG + HALDYFQYQ++ Sbjct: 589 LTSFLQRYWSDNQVSCTVTFDPETEGDQMKHALDYFQYQLK 629
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: D0MVF9_PHYIT (Ribonucleoside-triphosphate reductase (thioredoxin) n=2 Tax=Phytophthora infestans TaxID=4787 RepID=D0MVF9_PHYIT) HSP 1 Score: 53.5 bits (127), Expect = 5.430e-6 Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 0 Query: 17 QVSCTVTFDPATEGASLSHALDYFQYQVR 45 QVSCTVTFDP TEG+ L+H LDYFQYQ++ Sbjct: 574 QVSCTVTFDPKTEGSQLAHLLDYFQYQLK 602
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: A0A225VWJ8_9STRA (Ribonucleoside-triphosphate reductase (thioredoxin) n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225VWJ8_9STRA) HSP 1 Score: 53.5 bits (127), Expect = 5.460e-6 Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 0 Query: 17 QVSCTVTFDPATEGASLSHALDYFQYQVR 45 QVSCTVTFDP TEG+ L+H LDYFQYQ++ Sbjct: 616 QVSCTVTFDPKTEGSQLAHMLDYFQYQLK 644
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: D7FJK6_ECTSI (Ribonucleoside-triphosphate reductase (thioredoxin) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FJK6_ECTSI) HSP 1 Score: 53.5 bits (127), Expect = 5.460e-6 Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 0 Query: 17 QVSCTVTFDPATEGASLSHALDYFQYQVR 45 QVSCT+TFDP TEG L+HALDYFQYQ++ Sbjct: 611 QVSCTITFDPETEGHHLAHALDYFQYQLK 639
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: A0A7S3J8B8_9SPIT (Hypothetical protein (Fragment) n=1 Tax=Euplotes harpa TaxID=151035 RepID=A0A7S3J8B8_9SPIT) HSP 1 Score: 50.4 bits (119), Expect = 8.380e-6 Identity = 22/29 (75.86%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 17 QVSCTVTFDPATEGASLSHALDYFQYQVR 45 QVSCTVTFDP TEG SL AL+YFQYQ++ Sbjct: 55 QVSCTVTFDPKTEGESLKPALEYFQYQLK 83
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: H3GD43_PHYRM (Ribonucleoside-triphosphate reductase (thioredoxin) n=4 Tax=Phytophthora TaxID=4783 RepID=H3GD43_PHYRM) HSP 1 Score: 52.8 bits (125), Expect = 1.010e-5 Identity = 22/29 (75.86%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 17 QVSCTVTFDPATEGASLSHALDYFQYQVR 45 QVSCTVTFDP TEG L+H LDYFQYQ++ Sbjct: 538 QVSCTVTFDPKTEGLQLAHMLDYFQYQLK 566
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: A0A3R7GI44_9STRA (Ribonucleoside-triphosphate reductase (thioredoxin) n=4 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3R7GI44_9STRA) HSP 1 Score: 52.8 bits (125), Expect = 1.010e-5 Identity = 22/29 (75.86%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 17 QVSCTVTFDPATEGASLSHALDYFQYQVR 45 QVSCTVTFDP TEG +SH LDYFQYQ++ Sbjct: 554 QVSCTVTFDPKTEGPHISHMLDYFQYQLK 582
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: A0A8J5M3B0_9STRA (Ribonucleoside-triphosphate reductase (thioredoxin) n=1 Tax=Phytophthora aleatoria TaxID=2496075 RepID=A0A8J5M3B0_9STRA) HSP 1 Score: 52.8 bits (125), Expect = 1.020e-5 Identity = 22/29 (75.86%), Postives = 25/29 (86.21%), Query Frame = 0 Query: 17 QVSCTVTFDPATEGASLSHALDYFQYQVR 45 QVSCTVTFDP TEG L+H LDYFQYQ++ Sbjct: 606 QVSCTVTFDPKTEGPQLAHMLDYFQYQLK 634 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig11311.2.1 ID=prot_P-wetherbeei_contig11311.2.1|Name=mRNA_P-wetherbeei_contig11311.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=106bpback to top |