prot_P-wetherbeei_contig11291.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11291.1.1 vs. uniprot
Match: W7TQL4_9STRA (Cytochrome b-c1 complex subunit Rieske, mitochondrial n=2 Tax=Monodopsidaceae TaxID=425072 RepID=W7TQL4_9STRA) HSP 1 Score: 66.2 bits (160), Expect = 9.470e-12 Identity = 30/45 (66.67%), Postives = 35/45 (77.78%), Query Frame = 0 Query: 3 SQDHYFEKDRIHKGKGDPNKRTFVYFMLGAGRFIYASTARLTFLK 47 S D+Y+EKD++HK GDPNKR F YF+LG RFIYAS ARL LK Sbjct: 48 SFDNYYEKDKLHKKPGDPNKRDFTYFVLGGARFIYASAARLVALK 92
BLAST of mRNA_P-wetherbeei_contig11291.1.1 vs. uniprot
Match: A0A6V1WQS7_HETAK (Cytochrome b-c1 complex subunit Rieske, mitochondrial n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A6V1WQS7_HETAK) HSP 1 Score: 64.7 bits (156), Expect = 3.440e-11 Identity = 32/46 (69.57%), Postives = 35/46 (76.09%), Query Frame = 0 Query: 2 SSQDHYFEKDRIHKGKGDPNKRTFVYFMLGAGRFIYASTARLTFLK 47 SSQDHYFEKDR+ KG+ NKR F YFMLG RFIYAS ARL +K Sbjct: 46 SSQDHYFEKDRLAKGE---NKREFTYFMLGCSRFIYASAARLALIK 88
BLAST of mRNA_P-wetherbeei_contig11291.1.1 vs. uniprot
Match: D7FK16_ECTSI (Cytochrome b-c1 complex subunit Rieske, mitochondrial n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FK16_ECTSI) HSP 1 Score: 63.9 bits (154), Expect = 8.650e-11 Identity = 31/46 (67.39%), Postives = 36/46 (78.26%), Query Frame = 0 Query: 2 SSQDHYFEKDRIHKGKGDPNKRTFVYFMLGAGRFIYASTARLTFLK 47 ++QD YFEKDR+ KGDP KR F YFMLGA RF+YAS+ARL LK Sbjct: 69 TNQDGYFEKDRV--AKGDPGKREFTYFMLGASRFLYASSARLILLK 112
BLAST of mRNA_P-wetherbeei_contig11291.1.1 vs. uniprot
Match: A0A836CDL7_9STRA (Cytochrome b-c1 complex subunit Rieske, mitochondrial n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CDL7_9STRA) HSP 1 Score: 52.4 bits (124), Expect = 1.470e-6 Identity = 25/47 (53.19%), Postives = 32/47 (68.09%), Query Frame = 0 Query: 1 FSSQDHYFEKDRIHKGKGDPNKRTFVYFMLGAGRFIYASTARLTFLK 47 F SQD FEKDR+ G N + F YF+LG GRF+YASTAR+ ++ Sbjct: 57 FDSQDGAFEKDRVEPGT---NHKEFTYFLLGGGRFVYASTARVILIQ 100 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11291.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig11291.1.1 ID=prot_P-wetherbeei_contig11291.1.1|Name=mRNA_P-wetherbeei_contig11291.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=55bpback to top |