prot_P-wetherbeei_contig11149.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11149.1.1 vs. uniprot
Match: A0A1Q3P933_9BACT (Uncharacterized protein n=1 Tax=Dyadobacter sp. 50-39 TaxID=1895756 RepID=A0A1Q3P933_9BACT) HSP 1 Score: 54.3 bits (129), Expect = 2.270e-6 Identity = 28/54 (51.85%), Postives = 45/54 (83.33%), Query Frame = 0 Query: 6 LLATVAIFLISLSVYSQVVSSDSLDVLKARKEMLGISKKLNACRIELAEKENQI 59 +LA + ++LISLSV +QVVS DS+++LK +KE++ +SK+LN ++ELA+ ENQ+ Sbjct: 6 ILAVLGLWLISLSVSAQVVSKDSINMLKDQKEVIEVSKRLNERKLELAKLENQL 59
BLAST of mRNA_P-wetherbeei_contig11149.1.1 vs. uniprot
Match: UPI001F1D5579 (hypothetical protein n=1 Tax=Dyadobacter sp. CY261 TaxID=2907203 RepID=UPI001F1D5579) HSP 1 Score: 54.3 bits (129), Expect = 2.430e-6 Identity = 28/51 (54.90%), Postives = 42/51 (82.35%), Query Frame = 0 Query: 10 VAIFLISLSVYSQVVSSDSLDVLKARKEMLGISKKLNACRIELAEKENQIQ 60 V + LISLSV +QVVS DS+++LK +KE++ +SK+LN ++ELA+ ENQ+Q Sbjct: 10 VVLLLISLSVSAQVVSKDSINMLKDQKEVIEVSKRLNERKLELAKLENQVQ 60
BLAST of mRNA_P-wetherbeei_contig11149.1.1 vs. uniprot
Match: A0A1H6QIM6_9BACT (Uncharacterized protein n=2 Tax=Dyadobacter TaxID=120831 RepID=A0A1H6QIM6_9BACT) HSP 1 Score: 53.9 bits (128), Expect = 3.060e-6 Identity = 29/51 (56.86%), Postives = 41/51 (80.39%), Query Frame = 0 Query: 9 TVAIFLISLSVYSQVVSSDSLDVLKARKEMLGISKKLNACRIELAEKENQI 59 T+ I LISLS+ +QVVS DSL++LK +KE L +SK+LN ++ELA+ ENQ+ Sbjct: 9 TLGIMLISLSLSAQVVSKDSLNMLKQQKESLEVSKRLNERKLELAKLENQV 59 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11149.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig11149.1.1 ID=prot_P-wetherbeei_contig11149.1.1|Name=mRNA_P-wetherbeei_contig11149.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=152bpback to top |