prot_P-wetherbeei_contig10044.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10044.2.1 vs. uniprot
Match: A0A6H5JYH1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JYH1_9PHAE) HSP 1 Score: 75.9 bits (185), Expect = 4.900e-14 Identity = 43/82 (52.44%), Postives = 57/82 (69.51%), Query Frame = 0 Query: 6 IGAASAVQRLTLAAQTST-----VTAGGYRLELNGALTDCIAHDATAAEVAAALAALPDVRGGVSVDGRVFVDDGHYYPVTE 82 +G +S+VQRL L A +S + G YRL L +T+CI ++AT A++A+AL ALP+V GG SV GRVFVDDG YYPV + Sbjct: 3395 LGPSSSVQRLVLTAGSSNSPITPIVNGSYRLALGEHMTECIKYNATPADLASALGALPNVAGGASVFGRVFVDDGTYYPVND 3476
BLAST of mRNA_P-wetherbeei_contig10044.2.1 vs. uniprot
Match: D7FNA6_ECTSI (Similar to titin isoform N2-B n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FNA6_ECTSI) HSP 1 Score: 75.9 bits (185), Expect = 4.910e-14 Identity = 43/82 (52.44%), Postives = 57/82 (69.51%), Query Frame = 0 Query: 6 IGAASAVQRLTLAAQTST-----VTAGGYRLELNGALTDCIAHDATAAEVAAALAALPDVRGGVSVDGRVFVDDGHYYPVTE 82 +G +S+VQRL L A +S + G YRL L +T+CI ++AT A++A+AL ALP+V GG SV GRVFVDDG YYPV + Sbjct: 10870 LGPSSSVQRLVLTAGSSNSPITPIVNGSYRLALGEHMTECIKYNATPADLASALGALPNVAGGASVFGRVFVDDGTYYPVND 10951 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10044.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig10044.2.1 ID=prot_P-wetherbeei_contig10044.2.1|Name=mRNA_P-wetherbeei_contig10044.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=92bpback to top |