mRNA_P-wetherbeei_contig9742.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9742.1.1 vs. uniprot
Match: A0A6C2YXX3_9BACT (Uncharacterized protein n=1 Tax=Tuwongella immobilis TaxID=692036 RepID=A0A6C2YXX3_9BACT) HSP 1 Score: 53.5 bits (127), Expect = 3.400e-6 Identity = 27/71 (38.03%), Postives = 43/71 (60.56%), Query Frame = 1 Query: 19 LTPAVF-WDGGASTFSWLDPLNWSTDLLPGSGQSVTIGSGYSGITVTLTGLSNINSLTSYAGITLGAGGQL 228 +TPA+ WDGG W +PLNWS++ LPG+ V IG ++ + +TL + + S+TS + I + + G L Sbjct: 18 ITPAIVSWDGGGGNLLWSNPLNWSSNQLPGAADDVIIGDAFADVDITLGFTTKVASVTSKSDIFITSAGTL 88 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9742.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9742.1.1 >prot_P-wetherbeei_contig9742.1.1 ID=prot_P-wetherbeei_contig9742.1.1|Name=mRNA_P-wetherbeei_contig9742.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=92bp MPFLPALTPAVFWDGGASTFSWLDPLNWSTDLLPGSGQSVTIGSGYSGITback to top mRNA from alignment at P-wetherbeei_contig9742:922..1197- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9742.1.1 ID=mRNA_P-wetherbeei_contig9742.1.1|Name=mRNA_P-wetherbeei_contig9742.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=276bp|location=Sequence derived from alignment at P-wetherbeei_contig9742:922..1197- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9742:922..1197- >mRNA_P-wetherbeei_contig9742.1.1 ID=mRNA_P-wetherbeei_contig9742.1.1|Name=mRNA_P-wetherbeei_contig9742.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=276bp|location=Sequence derived from alignment at P-wetherbeei_contig9742:922..1197- (Phaeothamnion wetherbeei SAG_119_79)back to top |