mRNA_P-wetherbeei_contig9667.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9667.1.1 vs. uniprot
Match: C1MU61_MICPC (Predicted protein n=1 Tax=Micromonas pusilla (strain CCMP1545) TaxID=564608 RepID=C1MU61_MICPC) HSP 1 Score: 56.2 bits (134), Expect = 6.710e-6 Identity = 25/39 (64.10%), Postives = 28/39 (71.79%), Query Frame = 1 Query: 4 CMKAGCSKKAQPRSTLCRLHGGGRRCQREGCGKVDVGGG 120 C + GC+K A S CR HGGG+RCQREGCGK D GGG Sbjct: 408 CGRDGCAKHALSGSEHCRAHGGGKRCQREGCGKGDAGGG 446 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9667.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9667.1.1 >prot_P-wetherbeei_contig9667.1.1 ID=prot_P-wetherbeei_contig9667.1.1|Name=mRNA_P-wetherbeei_contig9667.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=190bp MKAGCSKKAQPRSTLCRLHGGGRRCQREGCGKVDVGGGLCRSHGGGKRCMback to top mRNA from alignment at P-wetherbeei_contig9667:11..586- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9667.1.1 ID=mRNA_P-wetherbeei_contig9667.1.1|Name=mRNA_P-wetherbeei_contig9667.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=576bp|location=Sequence derived from alignment at P-wetherbeei_contig9667:11..586- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9667:11..586- >mRNA_P-wetherbeei_contig9667.1.1 ID=mRNA_P-wetherbeei_contig9667.1.1|Name=mRNA_P-wetherbeei_contig9667.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=570bp|location=Sequence derived from alignment at P-wetherbeei_contig9667:11..586- (Phaeothamnion wetherbeei SAG_119_79)back to top |