mRNA_P-wetherbeei_contig9587.2.2 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9587.2.2 vs. uniprot
Match: A0A2U1P9Z3_ARTAN (Nudix hydrolase n=1 Tax=Artemisia annua TaxID=35608 RepID=A0A2U1P9Z3_ARTAN) HSP 1 Score: 61.2 bits (147), Expect = 6.110e-8 Identity = 33/54 (61.11%), Postives = 39/54 (72.22%), Query Frame = 2 Query: 8 MFPKGGWENDETVEEAASREAWEEAGVSKSTELFPFFLSLFSETRT*RLQDECT 169 +FPKGGWENDETVEEAA REAWEEAGV +L F +++T LQDEC+ Sbjct: 59 LFPKGGWENDETVEEAAVREAWEEAGVRG--DLMHFLGHFHFKSKT--LQDECS 108
BLAST of mRNA_P-wetherbeei_contig9587.2.2 vs. uniprot
Match: A0A0B7KJF2_BIOOC (Nudix hydrolase domain-containing protein n=1 Tax=Bionectria ochroleuca TaxID=29856 RepID=A0A0B7KJF2_BIOOC) HSP 1 Score: 58.5 bits (140), Expect = 3.330e-7 Identity = 30/60 (50.00%), Postives = 39/60 (65.00%), Query Frame = 2 Query: 5 WMFPKGGWENDETVEEAASREAWEEAGVSKSTELFPFFLSLFSETRT*RL-QDECTFAYY 181 W+ PKGGWE+DET E+AASREAWEEAG+S + F LS E R + +D + +Y Sbjct: 53 WVLPKGGWESDETCEQAASREAWEEAGISIQID---FNLSTIEEKRARKSSKDRAVYHFY 109
BLAST of mRNA_P-wetherbeei_contig9587.2.2 vs. uniprot
Match: A0A0A1TQD4_9HYPO (Putative Diadenosine hexaphosphate hydrolase n=1 Tax=Torrubiella hemipterigena TaxID=1531966 RepID=A0A0A1TQD4_9HYPO) HSP 1 Score: 57.8 bits (138), Expect = 7.410e-7 Identity = 28/60 (46.67%), Postives = 42/60 (70.00%), Query Frame = 2 Query: 5 WMFPKGGWENDETVEEAASREAWEEAGVSKSTELFPFFLSLFSETRT*RL-QDECTFAYY 181 W+ PKGGWE+DET EEAA+REAWEEAG++ +L L + E+R ++ +D+ + +Y Sbjct: 62 WVLPKGGWESDETCEEAATREAWEEAGITIQIDLD---LGVIEESRPLKMSKDQSQYHFY 118
BLAST of mRNA_P-wetherbeei_contig9587.2.2 vs. uniprot
Match: A0A2C9W4D4_MANES (Nudix hydrolase domain-containing protein n=6 Tax=Euphorbiaceae TaxID=3977 RepID=A0A2C9W4D4_MANES) HSP 1 Score: 57.4 bits (137), Expect = 1.060e-6 Identity = 32/53 (60.38%), Postives = 39/53 (73.58%), Query Frame = 2 Query: 8 MFPKGGWENDETVEEAASREAWEEAGVSKSTELFPFFLSLFSETRT*RLQDEC 166 +FPKGGWENDETVEEAA+REA EEAGV +L F + +++T LQDEC Sbjct: 59 LFPKGGWENDETVEEAAAREAIEEAGVRG--DLMDFIGNYHFKSKT--LQDEC 107
BLAST of mRNA_P-wetherbeei_contig9587.2.2 vs. uniprot
Match: A0A2G5EWK5_AQUCA (Nudix hydrolase domain-containing protein n=2 Tax=Thalictroideae TaxID=1463137 RepID=A0A2G5EWK5_AQUCA) HSP 1 Score: 57.8 bits (138), Expect = 1.060e-6 Identity = 25/28 (89.29%), Postives = 28/28 (100.00%), Query Frame = 2 Query: 5 WMFPKGGWENDETVEEAASREAWEEAGV 88 ++FPKGGWENDETVEEAA+REAWEEAGV Sbjct: 57 FLFPKGGWENDETVEEAAAREAWEEAGV 84
BLAST of mRNA_P-wetherbeei_contig9587.2.2 vs. uniprot
Match: A0A0R0KE69_SOYBN (Nudix hydrolase domain-containing protein n=11 Tax=Phaseoleae TaxID=163735 RepID=A0A0R0KE69_SOYBN) HSP 1 Score: 56.6 bits (135), Expect = 2.130e-6 Identity = 32/54 (59.26%), Postives = 36/54 (66.67%), Query Frame = 2 Query: 8 MFPKGGWENDETVEEAASREAWEEAGVSKSTELFPFFLSLFSETRT*RLQDECT 169 +FPKGGWENDETVEEAA REA EEAGV F + S+T LQDEC+ Sbjct: 57 LFPKGGWENDETVEEAAVREAIEEAGVRGDLMDFLGYYEFRSKT----LQDECS 106
BLAST of mRNA_P-wetherbeei_contig9587.2.2 vs. uniprot
Match: A0A086SUB3_ACRC1 (Diphosphoinositol polyphosphate phosphohydrolase-like protein n=1 Tax=Acremonium chrysogenum (strain ATCC 11550 / CBS 779.69 / DSM 880 / IAM 14645 / JCM 23072 / IMI 49137) TaxID=857340 RepID=A0A086SUB3_ACRC1) HSP 1 Score: 56.2 bits (134), Expect = 2.410e-6 Identity = 27/59 (45.76%), Postives = 37/59 (62.71%), Query Frame = 2 Query: 5 WMFPKGGWENDETVEEAASREAWEEAGVSKSTELFPFFLSLFSETRT*RLQDECTFAYY 181 W+ PKGGWE+DET E+AA+REAWEE G++ + F LS E R + E + Y+ Sbjct: 56 WVLPKGGWESDETCEQAATREAWEEGGINVRID---FSLSSIKEKRAPKTSKERSVYYF 111
BLAST of mRNA_P-wetherbeei_contig9587.2.2 vs. uniprot
Match: A0A084AW66_STACB (Nudix hydrolase domain-containing protein n=3 Tax=Stachybotrys TaxID=74721 RepID=A0A084AW66_STACB) HSP 1 Score: 55.5 bits (132), Expect = 4.640e-6 Identity = 27/59 (45.76%), Postives = 38/59 (64.41%), Query Frame = 2 Query: 5 WMFPKGGWENDETVEEAASREAWEEAGVSKSTELFPFFLSLFSETRT*RLQDECTFAYY 181 W+ PKGGWE+DET ++AA+REAWEEAG+S + + L F E R + E + Y+ Sbjct: 57 WVLPKGGWESDETCQDAAAREAWEEAGISIQVD---YDLGNFEEKRPPKSSKERSRYYF 112
BLAST of mRNA_P-wetherbeei_contig9587.2.2 vs. uniprot
Match: A0A1Y1ZLD6_9FUNG (Nudix hydrolase domain-containing protein (Fragment) n=1 Tax=Neocallimastix californiae TaxID=1754190 RepID=A0A1Y1ZLD6_9FUNG) HSP 1 Score: 54.7 bits (130), Expect = 6.290e-6 Identity = 23/28 (82.14%), Postives = 24/28 (85.71%), Query Frame = 2 Query: 5 WMFPKGGWENDETVEEAASREAWEEAGV 88 W+FPKGGWENDETV AA RE WEEAGV Sbjct: 28 WIFPKGGWENDETVTSAAMRETWEEAGV 55
BLAST of mRNA_P-wetherbeei_contig9587.2.2 vs. uniprot
Match: A0A8B7CE47_PHODC (nudix hydrolase 12, mitochondrial-like n=1 Tax=Phoenix dactylifera TaxID=42345 RepID=A0A8B7CE47_PHODC) HSP 1 Score: 55.8 bits (133), Expect = 6.320e-6 Identity = 24/29 (82.76%), Postives = 28/29 (96.55%), Query Frame = 2 Query: 2 DWMFPKGGWENDETVEEAASREAWEEAGV 88 D++FPKGGWENDE+VE+AA REAWEEAGV Sbjct: 58 DFIFPKGGWENDESVEQAARREAWEEAGV 86 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9587.2.2 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9587.2.2 >prot_P-wetherbeei_contig9587.2.2 ID=prot_P-wetherbeei_contig9587.2.2|Name=mRNA_P-wetherbeei_contig9587.2.2|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=158bp MQSGGYLVRSGARRDQRRSRNIRIREPAGREVQALHVRPRGEAGGGIPRAback to top mRNA from alignment at P-wetherbeei_contig9587:722..1831- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9587.2.2 ID=mRNA_P-wetherbeei_contig9587.2.2|Name=mRNA_P-wetherbeei_contig9587.2.2|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=1110bp|location=Sequence derived from alignment at P-wetherbeei_contig9587:722..1831- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9587:722..1831- >mRNA_P-wetherbeei_contig9587.2.2 ID=mRNA_P-wetherbeei_contig9587.2.2|Name=mRNA_P-wetherbeei_contig9587.2.2|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=474bp|location=Sequence derived from alignment at P-wetherbeei_contig9587:722..1831- (Phaeothamnion wetherbeei SAG_119_79)back to top |