mRNA_P-wetherbeei_contig9575.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9575.2.1 vs. uniprot
Match: A0A1D8AZP8_9BACT (Uncharacterized protein n=1 Tax=Lacunisphaera limnophila TaxID=1838286 RepID=A0A1D8AZP8_9BACT) HSP 1 Score: 61.2 bits (147), Expect = 5.890e-11 Identity = 26/31 (83.87%), Postives = 28/31 (90.32%), Query Frame = 1 Query: 4 MNVTRIDILTRGLTNRCPNCGGKTLFVPGIL 96 M VTR+ ILTRGLT+RCPNCGGKTLFVPG L Sbjct: 1 MRVTRLTILTRGLTHRCPNCGGKTLFVPGKL 31
BLAST of mRNA_P-wetherbeei_contig9575.2.1 vs. uniprot
Match: A0A3E1EAY0_9BACT (Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A3E1EAY0_9BACT) HSP 1 Score: 56.2 bits (134), Expect = 6.080e-9 Identity = 24/31 (77.42%), Postives = 25/31 (80.65%), Query Frame = 1 Query: 4 MNVTRIDILTRGLTNRCPNCGGKTLFVPGIL 96 M VTRI I+ RGLT RCPNCGGKTLF PG L Sbjct: 1 MQVTRIQIVARGLTIRCPNCGGKTLFKPGTL 31
BLAST of mRNA_P-wetherbeei_contig9575.2.1 vs. uniprot
Match: B1ZQ53_OPITP (Uncharacterized protein n=1 Tax=Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1) TaxID=452637 RepID=B1ZQ53_OPITP) HSP 1 Score: 56.2 bits (134), Expect = 6.320e-9 Identity = 24/31 (77.42%), Postives = 25/31 (80.65%), Query Frame = 1 Query: 4 MNVTRIDILTRGLTNRCPNCGGKTLFVPGIL 96 M VTRI I+ RGLTNRCPNCG TLFVPG L Sbjct: 1 MKVTRIQIVARGLTNRCPNCGDHTLFVPGKL 31
BLAST of mRNA_P-wetherbeei_contig9575.2.1 vs. uniprot
Match: A0A139SQV0_9BACT (Uncharacterized protein n=1 Tax=Cephaloticoccus capnophilus TaxID=1548208 RepID=A0A139SQV0_9BACT) HSP 1 Score: 52.8 bits (125), Expect = 1.350e-7 Identity = 23/31 (74.19%), Postives = 24/31 (77.42%), Query Frame = 1 Query: 4 MNVTRIDILTRGLTNRCPNCGGKTLFVPGIL 96 M V+R IL RGLTNRCPNCGGKTLF G L Sbjct: 1 MKVSRQQILIRGLTNRCPNCGGKTLFKKGSL 31
BLAST of mRNA_P-wetherbeei_contig9575.2.1 vs. uniprot
Match: A0A2A2RGW4_9BACT (DUF983 domain-containing protein n=1 Tax=Opitutae bacterium Tous-C8FEB TaxID=1982323 RepID=A0A2A2RGW4_9BACT) HSP 1 Score: 52.4 bits (124), Expect = 2.000e-7 Identity = 20/29 (68.97%), Postives = 24/29 (82.76%), Query Frame = 1 Query: 1 FMNVTRIDILTRGLTNRCPNCGGKTLFVP 87 + VTR+ I+TRGL NRCPNCGG+TLF P Sbjct: 1 MLKVTRLQIVTRGLANRCPNCGGRTLFRP 29
BLAST of mRNA_P-wetherbeei_contig9575.2.1 vs. uniprot
Match: A0A1H1M3I8_9BACT (Uncharacterized conserved protein, DUF983 family n=1 Tax=Opitutus sp. GAS368 TaxID=1882749 RepID=A0A1H1M3I8_9BACT) HSP 1 Score: 50.8 bits (120), Expect = 7.490e-7 Identity = 21/31 (67.74%), Postives = 23/31 (74.19%), Query Frame = 1 Query: 4 MNVTRIDILTRGLTNRCPNCGGKTLFVPGIL 96 M VTR I+ RGL NRCPNCGG+TLF G L Sbjct: 1 MQVTRGQIIARGLANRCPNCGGRTLFKTGTL 31
BLAST of mRNA_P-wetherbeei_contig9575.2.1 vs. uniprot
Match: UPI001C805B14 (DUF983 domain-containing protein n=1 Tax=Opitutus sp. WL0086 TaxID=2866162 RepID=UPI001C805B14) HSP 1 Score: 50.8 bits (120), Expect = 7.490e-7 Identity = 21/29 (72.41%), Postives = 23/29 (79.31%), Query Frame = 1 Query: 4 MNVTRIDILTRGLTNRCPNCGGKTLFVPG 90 M VTR I+ RGLTNRCPNCGG+TLF G Sbjct: 1 MQVTRGQIIARGLTNRCPNCGGRTLFQEG 29
BLAST of mRNA_P-wetherbeei_contig9575.2.1 vs. uniprot
Match: A0A2E4IYM4_9BACT (DUF983 domain-containing protein n=1 Tax=Opitutaceae bacterium TaxID=2006848 RepID=A0A2E4IYM4_9BACT) HSP 1 Score: 50.4 bits (119), Expect = 1.060e-6 Identity = 21/31 (67.74%), Postives = 22/31 (70.97%), Query Frame = 1 Query: 4 MNVTRIDILTRGLTNRCPNCGGKTLFVPGIL 96 M VTRI + RGLTNRCPNCGG TLF G Sbjct: 1 MKVTRIQTVIRGLTNRCPNCGGSTLFWEGTF 31
BLAST of mRNA_P-wetherbeei_contig9575.2.1 vs. uniprot
Match: A0A290QDZ0_9BACT (DUF983 domain-containing protein n=1 Tax=Nibricoccus aquaticus TaxID=2576891 RepID=A0A290QDZ0_9BACT) HSP 1 Score: 50.1 bits (118), Expect = 1.490e-6 Identity = 22/31 (70.97%), Postives = 23/31 (74.19%), Query Frame = 1 Query: 4 MNVTRIDILTRGLTNRCPNCGGKTLFVPGIL 96 MNVTR I RGLTN CPNCGG+TLF G L Sbjct: 1 MNVTRGKIAARGLTNCCPNCGGRTLFKEGSL 31
BLAST of mRNA_P-wetherbeei_contig9575.2.1 vs. uniprot
Match: A0A178IFT2_9BACT (Uncharacterized protein n=1 Tax=Opitutaceae bacterium TSB47 TaxID=1184151 RepID=A0A178IFT2_9BACT) HSP 1 Score: 50.1 bits (118), Expect = 1.490e-6 Identity = 21/29 (72.41%), Postives = 23/29 (79.31%), Query Frame = 1 Query: 4 MNVTRIDILTRGLTNRCPNCGGKTLFVPG 90 M VTR +L RGLTNRCPNCGG+TLF G Sbjct: 1 MRVTRGGLLARGLTNRCPNCGGRTLFRAG 29 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9575.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 21
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9575.2.1 >prot_P-wetherbeei_contig9575.2.1 ID=prot_P-wetherbeei_contig9575.2.1|Name=mRNA_P-wetherbeei_contig9575.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=34bp MNVTRIDILTRGLTNRCPNCGGKTLFVPGILGP*back to top mRNA from alignment at P-wetherbeei_contig9575:2306..2410- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9575.2.1 ID=mRNA_P-wetherbeei_contig9575.2.1|Name=mRNA_P-wetherbeei_contig9575.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=105bp|location=Sequence derived from alignment at P-wetherbeei_contig9575:2306..2410- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9575:2306..2410- >mRNA_P-wetherbeei_contig9575.2.1 ID=mRNA_P-wetherbeei_contig9575.2.1|Name=mRNA_P-wetherbeei_contig9575.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=102bp|location=Sequence derived from alignment at P-wetherbeei_contig9575:2306..2410- (Phaeothamnion wetherbeei SAG_119_79)back to top |