mRNA_P-wetherbeei_contig9331.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9331.1.1 vs. uniprot
Match: A0A7S2SBL1_9STRA (Hypothetical protein (Fragment) n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2SBL1_9STRA) HSP 1 Score: 68.6 bits (166), Expect = 2.240e-9 Identity = 36/54 (66.67%), Postives = 42/54 (77.78%), Query Frame = 3 Query: 405 ECERLRRDNERLNGELQAFDLDFFEEIEDLKYKYSQAVRKLRQYE----GGAGG 554 E RLR +N +L EL AFDLDFFEEIEDLKYKY++AV+KLRQ+E GG GG Sbjct: 683 ELTRLRDENAKLKQELSAFDLDFFEEIEDLKYKYAEAVKKLRQFEAASDGGGGG 736
BLAST of mRNA_P-wetherbeei_contig9331.1.1 vs. uniprot
Match: A0A7S3XY01_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3XY01_HETAK) HSP 1 Score: 64.7 bits (156), Expect = 1.680e-8 Identity = 32/49 (65.31%), Postives = 39/49 (79.59%), Query Frame = 3 Query: 399 EAECERLRRDNERLNGELQAFDLDFFEEIEDLKYKYSQAVRKLRQYEGG 545 E E RLR +N +L ELQAFDLDFFEEIEDLK+KY++A RKL+ Y+ G Sbjct: 225 EEENARLREENAKLARELQAFDLDFFEEIEDLKFKYAEAQRKLQAYQNG 273
BLAST of mRNA_P-wetherbeei_contig9331.1.1 vs. uniprot
Match: K3WSN7_GLOUD (Uncharacterized protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WSN7_GLOUD) HSP 1 Score: 62.0 bits (149), Expect = 6.370e-8 Identity = 31/49 (63.27%), Postives = 37/49 (75.51%), Query Frame = 3 Query: 393 ELEAECERLRRDNERLNGELQAFDLDFFEEIEDLKYKYSQAVRKLRQYE 539 ELEA E L +N +L EL AFD +FFEEIEDLKYKY+QAVR+ +Q E Sbjct: 148 ELEAHIEALEEENAKLQNELAAFDEEFFEEIEDLKYKYAQAVREKQQLE 196
BLAST of mRNA_P-wetherbeei_contig9331.1.1 vs. uniprot
Match: A0A7S2SL49_9STRA (Hypothetical protein n=2 Tax=labyrinthulid quahog parasite QPX TaxID=96639 RepID=A0A7S2SL49_9STRA) HSP 1 Score: 63.9 bits (154), Expect = 9.400e-8 Identity = 32/47 (68.09%), Postives = 38/47 (80.85%), Query Frame = 3 Query: 393 ELEAECERLRRDNERLNGELQAFDLDFFEEIEDLKYKYSQAVRKLRQ 533 +L E +RL R+N+RL EL AFDLDFFEEIEDLKYKY QAV++ RQ Sbjct: 2309 DLITENQRLERENQRLLNELNAFDLDFFEEIEDLKYKYQQAVQENRQ 2355
BLAST of mRNA_P-wetherbeei_contig9331.1.1 vs. uniprot
Match: A0A0P1A9G6_PLAHL (Centrosomeassociated protein n=1 Tax=Plasmopara halstedii TaxID=4781 RepID=A0A0P1A9G6_PLAHL) HSP 1 Score: 63.2 bits (152), Expect = 1.690e-7 Identity = 32/49 (65.31%), Postives = 36/49 (73.47%), Query Frame = 3 Query: 393 ELEAECERLRRDNERLNGELQAFDLDFFEEIEDLKYKYSQAVRKLRQYE 539 ELEA+ L +N +L EL AFD DFFEEIEDLKYKY+QAVR RQ E Sbjct: 2265 ELEAQVHELEDENTKLTNELSAFDEDFFEEIEDLKYKYTQAVRDKRQLE 2313
BLAST of mRNA_P-wetherbeei_contig9331.1.1 vs. uniprot
Match: A0A329RIS4_9STRA (Uncharacterized protein n=2 Tax=Phytophthora TaxID=4783 RepID=A0A329RIS4_9STRA) HSP 1 Score: 62.4 bits (150), Expect = 3.040e-7 Identity = 38/73 (52.05%), Postives = 45/73 (61.64%), Query Frame = 3 Query: 393 ELEAECERLRRDNERLNGELQAFDLDFFEEIEDLKYKYSQAVRKLRQYEGGAGGXXXXXPSAAGAGPSAAENR 611 ELEA+ L +N +L EL AFD DFFEEIEDLKYKY+QAVR RQ E SA G P++A +R Sbjct: 2269 ELEAQVLELEDENTKLTNELAAFDEDFFEEIEDLKYKYTQAVRDKRQLE------KRFARSADGISPASAPSR 2335
BLAST of mRNA_P-wetherbeei_contig9331.1.1 vs. uniprot
Match: A0A3F2RLU5_9STRA (Uncharacterized protein n=1 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3F2RLU5_9STRA) HSP 1 Score: 62.0 bits (149), Expect = 3.830e-7 Identity = 35/58 (60.34%), Postives = 40/58 (68.97%), Query Frame = 3 Query: 393 ELEAECERLRRDNERLNGELQAFDLDFFEEIEDLKYKYSQAVRKLRQYE----GGAGG 554 EL+A+ L +N +L EL AFD DFFEEIEDLKYKY+QAVR RQ E GG GG Sbjct: 1269 ELQAQVLELEDENTKLTNELAAFDEDFFEEIEDLKYKYAQAVRDKRQLEKRLAGGPGG 1326
BLAST of mRNA_P-wetherbeei_contig9331.1.1 vs. uniprot
Match: A0A3R7G134_9STRA (Uncharacterized protein n=2 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3R7G134_9STRA) HSP 1 Score: 62.0 bits (149), Expect = 4.040e-7 Identity = 35/58 (60.34%), Postives = 40/58 (68.97%), Query Frame = 3 Query: 393 ELEAECERLRRDNERLNGELQAFDLDFFEEIEDLKYKYSQAVRKLRQYE----GGAGG 554 EL+A+ L +N +L EL AFD DFFEEIEDLKYKY+QAVR RQ E GG GG Sbjct: 2031 ELQAQVLELEDENTKLTNELAAFDEDFFEEIEDLKYKYAQAVRDKRQLEKRLTGGLGG 2088
BLAST of mRNA_P-wetherbeei_contig9331.1.1 vs. uniprot
Match: A0A662WHV4_9STRA (Uncharacterized protein n=2 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662WHV4_9STRA) HSP 1 Score: 62.0 bits (149), Expect = 4.080e-7 Identity = 35/58 (60.34%), Postives = 39/58 (67.24%), Query Frame = 3 Query: 393 ELEAECERLRRDNERLNGELQAFDLDFFEEIEDLKYKYSQAVRKLRQYE----GGAGG 554 ELE + L +N +L EL AFD DFFEEIEDLKYKY+QAVR RQ E GG GG Sbjct: 2312 ELETQVFELEDENTKLTNELAAFDEDFFEEIEDLKYKYAQAVRDKRQLEKRLAGGTGG 2369
BLAST of mRNA_P-wetherbeei_contig9331.1.1 vs. uniprot
Match: A0A7S2F5N7_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2F5N7_9STRA) HSP 1 Score: 59.7 bits (143), Expect = 6.450e-7 Identity = 27/43 (62.79%), Postives = 36/43 (83.72%), Query Frame = 3 Query: 411 ERLRRDNERLNGELQAFDLDFFEEIEDLKYKYSQAVRKLRQYE 539 E L+++N RL GEL FD+ FF+EIEDLKYKY+QA+RKL+ Y+ Sbjct: 188 EALQKENVRLKGELSHFDVSFFDEIEDLKYKYAQALRKLKYYD 230 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9331.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9331.1.1 >prot_P-wetherbeei_contig9331.1.1 ID=prot_P-wetherbeei_contig9331.1.1|Name=mRNA_P-wetherbeei_contig9331.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=157bp MGPVVLRLLLFQPPSAAPALFYWPHRADLAASRGSTGGSEHGGYGGSYSGback to top mRNA from alignment at P-wetherbeei_contig9331:2..1300+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9331.1.1 ID=mRNA_P-wetherbeei_contig9331.1.1|Name=mRNA_P-wetherbeei_contig9331.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=1299bp|location=Sequence derived from alignment at P-wetherbeei_contig9331:2..1300+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9331:2..1300+ >mRNA_P-wetherbeei_contig9331.1.1 ID=mRNA_P-wetherbeei_contig9331.1.1|Name=mRNA_P-wetherbeei_contig9331.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=471bp|location=Sequence derived from alignment at P-wetherbeei_contig9331:2..1300+ (Phaeothamnion wetherbeei SAG_119_79)back to top |