mRNA_P-wetherbeei_contig9298.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9298.1.1 vs. uniprot
Match: A0A835ZC43_9STRA (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZC43_9STRA) HSP 1 Score: 77.4 bits (189), Expect = 1.200e-11 Identity = 39/66 (59.09%), Postives = 48/66 (72.73%), Query Frame = 1 Query: 466 FQMGVSPSRS--TSPRGMRSACNFCHTKRIKCNRDEGAT---KCQQCVQRGMVCKFSPKEKTGPKP 648 F M +P + TSPR +RSAC++CHTKRIKC RD+ +CQQCV+R + CKFS KEKTGPKP Sbjct: 15 FPMRCTPGQQGGTSPRLLRSACDWCHTKRIKCKRDDSEPLGGRCQQCVRRNIECKFSYKEKTGPKP 80
BLAST of mRNA_P-wetherbeei_contig9298.1.1 vs. uniprot
Match: A0A835YH07_9STRA (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YH07_9STRA) HSP 1 Score: 70.9 bits (172), Expect = 1.480e-9 Identity = 31/46 (67.39%), Postives = 39/46 (84.78%), Query Frame = 1 Query: 511 MRSACNFCHTKRIKCNRDEGATKCQQCVQRGMVCKFSPKEKTGPKP 648 +R+AC++CH+KRIKC +G KCQQC+QRG+ CKFS KEKTGPKP Sbjct: 61 LRNACDWCHSKRIKCRHTDGP-KCQQCLQRGLECKFSVKEKTGPKP 105
BLAST of mRNA_P-wetherbeei_contig9298.1.1 vs. uniprot
Match: A0A835Z4W4_9STRA (RNB domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z4W4_9STRA) HSP 1 Score: 62.4 bits (150), Expect = 9.170e-7 Identity = 30/53 (56.60%), Postives = 38/53 (71.70%), Query Frame = 1 Query: 490 RSTSPRGMRSACNFCHTKRIKCNRDEGATKCQQCVQRGMVCKFSPKEKTGPKP 648 R+ P ++ +FCH+KRIKC + G +KCQQC QR + CKFS KEKTGPKP Sbjct: 708 RAGQPLTVKRCGDFCHSKRIKC-KSVGGSKCQQCTQRLIECKFSVKEKTGPKP 759
BLAST of mRNA_P-wetherbeei_contig9298.1.1 vs. uniprot
Match: A0A0U5GQM4_ASPCI (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Aspergillus calidoustus TaxID=454130 RepID=A0A0U5GQM4_ASPCI) HSP 1 Score: 61.2 bits (147), Expect = 1.020e-6 Identity = 24/54 (44.44%), Postives = 37/54 (68.52%), Query Frame = 1 Query: 484 PSRSTSPRGMRSACNFCHTKRIKCNRDEGATKCQQCVQRGMVCKFSPKEKTGPK 645 P RS PR RSACN CHT++++C R G ++C++C++ C+F+P+ K G K Sbjct: 4 PHRSNQPRKTRSACNKCHTQKLRCTRKPGQSRCERCLRLNAECRFAPRAKRGSK 57 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9298.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9298.1.1 >prot_P-wetherbeei_contig9298.1.1 ID=prot_P-wetherbeei_contig9298.1.1|Name=mRNA_P-wetherbeei_contig9298.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=266bp MEGFPQSMMPSLMVPSMFSAGMLPTLSTATPPPTPGGGGQKFQMGVSPSRback to top mRNA from alignment at P-wetherbeei_contig9298:887..2412+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9298.1.1 ID=mRNA_P-wetherbeei_contig9298.1.1|Name=mRNA_P-wetherbeei_contig9298.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=1526bp|location=Sequence derived from alignment at P-wetherbeei_contig9298:887..2412+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9298:887..2412+ >mRNA_P-wetherbeei_contig9298.1.1 ID=mRNA_P-wetherbeei_contig9298.1.1|Name=mRNA_P-wetherbeei_contig9298.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=798bp|location=Sequence derived from alignment at P-wetherbeei_contig9298:887..2412+ (Phaeothamnion wetherbeei SAG_119_79)back to top |