mRNA_P-wetherbeei_contig12974.3.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12974.3.1 vs. uniprot
Match: A0A7S2RFT5_9STRA (Hypothetical protein (Fragment) n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2RFT5_9STRA) HSP 1 Score: 71.2 bits (173), Expect = 1.220e-13 Identity = 33/72 (45.83%), Postives = 47/72 (65.28%), Query Frame = 1 Query: 1 GQHVVASWELDEMCRQFERDHILRVYVPLNRPLHTLSEAQKEECIVQADAHLKRHHGRGYLPQLSRDEVRRL 216 GQHVV+ WELD MCRQFER+ IL+VY+ + L+E + E + QAD +K G+ + Q++ +EVR L Sbjct: 27 GQHVVSRWELDTMCRQFEREDILQVYMQKGQSPSALAEEEALELLAQADTRMKVAKGKALMKQVTEEEVREL 98
BLAST of mRNA_P-wetherbeei_contig12974.3.1 vs. uniprot
Match: A0A7S2B712_9STRA (Hypothetical protein n=1 Tax=Florenciella parvula TaxID=236787 RepID=A0A7S2B712_9STRA) HSP 1 Score: 71.6 bits (174), Expect = 3.740e-13 Identity = 33/69 (47.83%), Postives = 47/69 (68.12%), Query Frame = 1 Query: 1 GQHVVASWELDEMCRQFERDHILRVYVPLNRPLHTLSEAQKEECIVQADAHLKRHHGRGYLPQLSRDEV 207 GQHVV +WELD MCRQFER+ IL++Y+ + L+E Q EE + QAD+ LK G+ + Q++ +EV Sbjct: 43 GQHVVGNWELDTMCRQFEREDILQIYMLPGQTHSNLTEDQAEEILAQADSRLKVAKGKAMMKQVTPEEV 111 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12974.3.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig12974.3.1 >prot_P-wetherbeei_contig12974.3.1 ID=prot_P-wetherbeei_contig12974.3.1|Name=mRNA_P-wetherbeei_contig12974.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=73bp GQHVVASWELDEMCRQFERDHILRVYVPLNRPLHTLSEAQKEECIVQADAback to top mRNA from alignment at P-wetherbeei_contig12974:1688..1906- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig12974.3.1 ID=mRNA_P-wetherbeei_contig12974.3.1|Name=mRNA_P-wetherbeei_contig12974.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=219bp|location=Sequence derived from alignment at P-wetherbeei_contig12974:1688..1906- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig12974:1688..1906- >mRNA_P-wetherbeei_contig12974.3.1 ID=mRNA_P-wetherbeei_contig12974.3.1|Name=mRNA_P-wetherbeei_contig12974.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=219bp|location=Sequence derived from alignment at P-wetherbeei_contig12974:1688..1906- (Phaeothamnion wetherbeei SAG_119_79)back to top |