mRNA_P-wetherbeei_contig12818.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12818.1.1 vs. uniprot
Match: A0A835Z1E8_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z1E8_9STRA) HSP 1 Score: 69.3 bits (168), Expect = 6.400e-13 Identity = 32/42 (76.19%), Postives = 35/42 (83.33%), Query Frame = 1 Query: 67 ALILATVCRLWGVGLALRGPAGSMRTAVDAMAQYQTWAVRFF 192 ALILATVCR+WG GLALRGPAGSMR +V+ MA YQ W VR F Sbjct: 42 ALILATVCRIWGTGLALRGPAGSMRKSVEQMANYQIWTVRLF 83 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12818.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig12818.1.1 >prot_P-wetherbeei_contig12818.1.1 ID=prot_P-wetherbeei_contig12818.1.1|Name=mRNA_P-wetherbeei_contig12818.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=56bp MHLLLRFIICRRRQALILATVCRLWGVGLALRGPAGSMRTAVDAMAQYQTback to top mRNA from alignment at P-wetherbeei_contig12818:1740..1931+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig12818.1.1 ID=mRNA_P-wetherbeei_contig12818.1.1|Name=mRNA_P-wetherbeei_contig12818.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=192bp|location=Sequence derived from alignment at P-wetherbeei_contig12818:1740..1931+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig12818:1740..1931+ >mRNA_P-wetherbeei_contig12818.1.1 ID=mRNA_P-wetherbeei_contig12818.1.1|Name=mRNA_P-wetherbeei_contig12818.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=168bp|location=Sequence derived from alignment at P-wetherbeei_contig12818:1740..1931+ (Phaeothamnion wetherbeei SAG_119_79)back to top |