mRNA_P-wetherbeei_contig12735.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12735.1.1 vs. uniprot
Match: A0A354GM70_9BACT (Uncharacterized protein n=1 Tax=Planctomycetales bacterium TaxID=2053591 RepID=A0A354GM70_9BACT) HSP 1 Score: 49.7 bits (117), Expect = 1.430e-5 Identity = 28/52 (53.85%), Postives = 34/52 (65.38%), Query Frame = 1 Query: 22 DAKALEALAAYQPQAKSDDLGRVVELKLDGPQVDDLALDHVAGLSELKVLSL 177 DA L LA Y K D+ GRV+E+ L+G QVDD AL H+ LSEL+ LSL Sbjct: 19 DAICLAGLAPYHDTHKIDENGRVIEVTLEGRQVDDAALIHLQNLSELRRLSL 70 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12735.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig12735.1.1 >prot_P-wetherbeei_contig12735.1.1 ID=prot_P-wetherbeei_contig12735.1.1|Name=mRNA_P-wetherbeei_contig12735.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=79bp KAPAPSPDAKALEALAAYQPQAKSDDLGRVVELKLDGPQVDDLALDHVAGback to top mRNA from alignment at P-wetherbeei_contig12735:1..237- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig12735.1.1 ID=mRNA_P-wetherbeei_contig12735.1.1|Name=mRNA_P-wetherbeei_contig12735.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=237bp|location=Sequence derived from alignment at P-wetherbeei_contig12735:1..237- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig12735:1..237- >mRNA_P-wetherbeei_contig12735.1.1 ID=mRNA_P-wetherbeei_contig12735.1.1|Name=mRNA_P-wetherbeei_contig12735.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=237bp|location=Sequence derived from alignment at P-wetherbeei_contig12735:1..237- (Phaeothamnion wetherbeei SAG_119_79)back to top |