mRNA_P-wetherbeei_contig12681.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12681.1.1 vs. uniprot
Match: A0A835ZE93_9STRA (BED-type domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZE93_9STRA) HSP 1 Score: 103 bits (256), Expect = 2.710e-24 Identity = 45/63 (71.43%), Postives = 52/63 (82.54%), Query Frame = 1 Query: 1 MGKKKKKTTEVDKEDIWCFYCDRSFENEEVLIQHQKAKHFKCSICNKKLTTGSGMKIHAQQVH 189 MGKKKK+ E +KE WCFYCDR F++EEVLIQHQKAKHFKC +CNKKLTT G+ +H QQVH Sbjct: 1 MGKKKKQKVEEEKEQPWCFYCDRVFDHEEVLIQHQKAKHFKCLVCNKKLTTAGGLVVHCQQVH 63
BLAST of mRNA_P-wetherbeei_contig12681.1.1 vs. uniprot
Match: A0A7S3YKR3_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3YKR3_HETAK) HSP 1 Score: 96.3 bits (238), Expect = 3.580e-24 Identity = 42/63 (66.67%), Postives = 51/63 (80.95%), Query Frame = 1 Query: 1 MGKKKKKTTEVDKEDIWCFYCDRSFENEEVLIQHQKAKHFKCSICNKKLTTGSGMKIHAQQVH 189 MGKKKKKT ++E WCFYC+R FE+E+VLIQHQK+KHFKC +CNKKL+T GM +H QVH Sbjct: 1 MGKKKKKTAVREEEKPWCFYCERIFEDEKVLIQHQKSKHFKCHVCNKKLSTAGGMVVHCLQVH 63
BLAST of mRNA_P-wetherbeei_contig12681.1.1 vs. uniprot
Match: UPI0019240AF9 (protein SUPPRESSOR OF FRI 4-like n=1 Tax=Hibiscus syriacus TaxID=106335 RepID=UPI0019240AF9) HSP 1 Score: 89.4 bits (220), Expect = 7.870e-22 Identity = 37/63 (58.73%), Postives = 49/63 (77.78%), Query Frame = 1 Query: 1 MGKKKKKTTEVDKEDIWCFYCDRSFENEEVLIQHQKAKHFKCSICNKKLTTGSGMKIHAQQVH 189 MGKKKK+ + +WC+YCDR F++E++L+QHQKAKHFKC +C+KKL+T GM IH QVH Sbjct: 1 MGKKKKRVSST----VWCYYCDREFDDEKILVQHQKAKHFKCHVCHKKLSTAGGMAIHVLQVH 59
BLAST of mRNA_P-wetherbeei_contig12681.1.1 vs. uniprot
Match: A0A2P2K923_RHIMU (Protein SUPPRESSOR OF FRI 4 n=1 Tax=Rhizophora mucronata TaxID=61149 RepID=A0A2P2K923_RHIMU) HSP 1 Score: 88.6 bits (218), Expect = 9.430e-22 Identity = 37/63 (58.73%), Postives = 49/63 (77.78%), Query Frame = 1 Query: 1 MGKKKKKTTEVDKEDIWCFYCDRSFENEEVLIQHQKAKHFKCSICNKKLTTGSGMKIHAQQVH 189 MGKKKK+ + +WC+YCDR F++E++L+QHQKAKHFKC +C+KKL+T GM IH QVH Sbjct: 1 MGKKKKRASSK----VWCYYCDREFDDEKILVQHQKAKHFKCHVCHKKLSTAGGMAIHVLQVH 59
BLAST of mRNA_P-wetherbeei_contig12681.1.1 vs. uniprot
Match: A0A427B758_ENSVE (BED-type domain-containing protein n=2 Tax=Ensete ventricosum TaxID=4639 RepID=A0A427B758_ENSVE) HSP 1 Score: 89.0 bits (219), Expect = 1.320e-21 Identity = 38/63 (60.32%), Postives = 50/63 (79.37%), Query Frame = 1 Query: 1 MGKKKKKTTEVDKEDIWCFYCDRSFENEEVLIQHQKAKHFKCSICNKKLTTGSGMKIHAQQVH 189 MGKKKK+ ++V WC+YCDR F++E++L+QHQKAKHFKC +C+KKL+T GM IH QVH Sbjct: 1 MGKKKKRPSKV-----WCYYCDREFDDEKILVQHQKAKHFKCHVCHKKLSTAGGMAIHVLQVH 58
BLAST of mRNA_P-wetherbeei_contig12681.1.1 vs. uniprot
Match: A0A5A7PK62_STRAF (Zinc finger family protein n=1 Tax=Striga asiatica TaxID=4170 RepID=A0A5A7PK62_STRAF) HSP 1 Score: 95.1 bits (235), Expect = 1.610e-21 Identity = 42/63 (66.67%), Postives = 51/63 (80.95%), Query Frame = 1 Query: 1 MGKKKKKTTEVDKEDIWCFYCDRSFENEEVLIQHQKAKHFKCSICNKKLTTGSGMKIHAQQVH 189 MGKKKKK VDK +WC+YCDR FE+E++L+QHQKAKHFKC +C+KKL+T GM IH QVH Sbjct: 1 MGKKKKKRGAVDK--MWCYYCDREFEDEKILVQHQKAKHFKCHVCHKKLSTAGGMAIHVLQVH 61
BLAST of mRNA_P-wetherbeei_contig12681.1.1 vs. uniprot
Match: A0A8B8N7B5_9MYRT (protein SUPPRESSOR OF FRI 4-like n=1 Tax=Rhodamnia argentea TaxID=178133 RepID=A0A8B8N7B5_9MYRT) HSP 1 Score: 88.6 bits (218), Expect = 1.980e-21 Identity = 38/63 (60.32%), Postives = 49/63 (77.78%), Query Frame = 1 Query: 1 MGKKKKKTTEVDKEDIWCFYCDRSFENEEVLIQHQKAKHFKCSICNKKLTTGSGMKIHAQQVH 189 MGKKKK+ + +WC+YCDR F++E++L+QHQKAKHFKC C+KKL+T SGM IH QVH Sbjct: 1 MGKKKKRASSK----VWCYYCDREFDDEKILVQHQKAKHFKCHACHKKLSTASGMAIHVLQVH 59
BLAST of mRNA_P-wetherbeei_contig12681.1.1 vs. uniprot
Match: A0A2I0AJ76_9ASPA (BED-type domain-containing protein n=1 Tax=Apostasia shenzhenica TaxID=1088818 RepID=A0A2I0AJ76_9ASPA) HSP 1 Score: 89.0 bits (219), Expect = 2.040e-21 Identity = 38/63 (60.32%), Postives = 50/63 (79.37%), Query Frame = 1 Query: 1 MGKKKKKTTEVDKEDIWCFYCDRSFENEEVLIQHQKAKHFKCSICNKKLTTGSGMKIHAQQVH 189 MGKKKK+ ++V WC+YCDR F++E++L+QHQKAKHFKC +C+KKL+T GM IH QVH Sbjct: 1 MGKKKKRPSKV-----WCYYCDREFDDEKILVQHQKAKHFKCHVCHKKLSTAGGMAIHVLQVH 58
BLAST of mRNA_P-wetherbeei_contig12681.1.1 vs. uniprot
Match: A0A834FYY0_RHOSS (Uncharacterized protein n=1 Tax=Rhododendron simsii TaxID=118357 RepID=A0A834FYY0_RHOSS) HSP 1 Score: 88.6 bits (218), Expect = 2.090e-21 Identity = 37/63 (58.73%), Postives = 50/63 (79.37%), Query Frame = 1 Query: 1 MGKKKKKTTEVDKEDIWCFYCDRSFENEEVLIQHQKAKHFKCSICNKKLTTGSGMKIHAQQVH 189 MGKKKK+ +++WC+YCDR F++E++L+QHQKAKHFKC +C+KKL+T GM IH QVH Sbjct: 1 MGKKKKRAA---LKEVWCYYCDREFDDEKILVQHQKAKHFKCHVCHKKLSTAGGMVIHVLQVH 60
BLAST of mRNA_P-wetherbeei_contig12681.1.1 vs. uniprot
Match: A0A426Z810_ENSVE (BED-type domain-containing protein n=1 Tax=Ensete ventricosum TaxID=4639 RepID=A0A426Z810_ENSVE) HSP 1 Score: 87.8 bits (216), Expect = 2.570e-21 Identity = 37/63 (58.73%), Postives = 50/63 (79.37%), Query Frame = 1 Query: 1 MGKKKKKTTEVDKEDIWCFYCDRSFENEEVLIQHQKAKHFKCSICNKKLTTGSGMKIHAQQVH 189 MGKKKK+ +++ WC+YCDR F++E++L+QHQKAKHFKC +C+KKL+T GM IH QVH Sbjct: 1 MGKKKKRPSKM-----WCYYCDREFDDEKILVQHQKAKHFKCHVCHKKLSTAGGMAIHVLQVH 58 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12681.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig12681.1.1 >prot_P-wetherbeei_contig12681.1.1 ID=prot_P-wetherbeei_contig12681.1.1|Name=mRNA_P-wetherbeei_contig12681.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=63bp MGKKKKKTTEVDKEDIWCFYCDRSFENEEVLIQHQKAKHFKCSICNKKLTback to top mRNA from alignment at P-wetherbeei_contig12681:1..535- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig12681.1.1 ID=mRNA_P-wetherbeei_contig12681.1.1|Name=mRNA_P-wetherbeei_contig12681.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=535bp|location=Sequence derived from alignment at P-wetherbeei_contig12681:1..535- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig12681:1..535- >mRNA_P-wetherbeei_contig12681.1.1 ID=mRNA_P-wetherbeei_contig12681.1.1|Name=mRNA_P-wetherbeei_contig12681.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=189bp|location=Sequence derived from alignment at P-wetherbeei_contig12681:1..535- (Phaeothamnion wetherbeei SAG_119_79)back to top |