mRNA_P-wetherbeei_contig1214.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1214.2.1 vs. uniprot
Match: R7TC80_CAPTE (Nucleolar protein 10 n=1 Tax=Capitella teleta TaxID=283909 RepID=R7TC80_CAPTE) HSP 1 Score: 101 bits (251), Expect = 3.240e-26 Identity = 47/61 (77.05%), Postives = 52/61 (85.25%), Query Frame = 1 Query: 1 MHLMYYLDESGKRVYTLQKMDPQGGQTLSAHPARFSPDDQFSKQRINNKLRYGLLPTQQPK 183 M LMYYL ESG+RVYT++K+DP G T SAHPARFSPDDQFSKQR NK R+GLLPTQQPK Sbjct: 1 MFLMYYLSESGERVYTMEKVDPNGKPTYSAHPARFSPDDQFSKQRYLNKKRFGLLPTQQPK 61
BLAST of mRNA_P-wetherbeei_contig1214.2.1 vs. uniprot
Match: L8H2Y9_ACACA (Nucleolar protein 10 n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8H2Y9_ACACA) HSP 1 Score: 98.6 bits (244), Expect = 3.770e-25 Identity = 43/60 (71.67%), Postives = 53/60 (88.33%), Query Frame = 1 Query: 1 MHLMYYLDESGKRVYTLQKMDPQGGQTLSAHPARFSPDDQFSKQRINNKLRYGLLPTQQP 180 MHLMYYLD+ GKRVYTL+K +P+G T+SAHPARFSPDD+FS+QR+ K R+G+LPTQQP Sbjct: 1 MHLMYYLDKDGKRVYTLKKSNPEGTATVSAHPARFSPDDKFSRQRVTLKKRFGILPTQQP 60
BLAST of mRNA_P-wetherbeei_contig1214.2.1 vs. uniprot
Match: J9Q3Z9_OSTED (Nucleolar protein 10 (Fragment) n=1 Tax=Ostrea edulis TaxID=37623 RepID=J9Q3Z9_OSTED) HSP 1 Score: 98.2 bits (243), Expect = 8.490e-25 Identity = 46/62 (74.19%), Postives = 52/62 (83.87%), Query Frame = 1 Query: 1 MHLMYYLDESGKRVYTLQKMDPQGGQTLSAHPARFSPDDQFSKQRINNKLRYGLLPTQQPKV 186 M LMYYL+ESG +VYTL+K DP G TLSAHPARFSPDD+FSKQR+ K R+GLLPTQQPK Sbjct: 18 MLLMYYLNESGDKVYTLKKTDPMGCPTLSAHPARFSPDDKFSKQRVTLKKRFGLLPTQQPKA 79
BLAST of mRNA_P-wetherbeei_contig1214.2.1 vs. uniprot
Match: UPI0006C94F3D (H/ACA ribonucleoprotein complex subunit 3 n=1 Tax=Copidosoma floridanum TaxID=29053 RepID=UPI0006C94F3D) HSP 1 Score: 97.4 bits (241), Expect = 1.080e-24 Identity = 43/60 (71.67%), Postives = 53/60 (88.33%), Query Frame = 1 Query: 1 MHLMYYLDESGKRVYTLQKMDPQGGQTLSAHPARFSPDDQFSKQRINNKLRYGLLPTQQP 180 M+LMYYLD++G R+YTL+KMDP G TLSAHPARFSP+D++SK+RI K R+GLLPTQQP Sbjct: 1 MYLMYYLDDNGNRIYTLKKMDPYGKPTLSAHPARFSPEDKYSKERITLKRRFGLLPTQQP 60
BLAST of mRNA_P-wetherbeei_contig1214.2.1 vs. uniprot
Match: A0A061SA74_9CHLO (Nucleolar protein 10 n=1 Tax=Tetraselmis sp. GSL018 TaxID=582737 RepID=A0A061SA74_9CHLO) HSP 1 Score: 96.7 bits (239), Expect = 2.180e-24 Identity = 43/64 (67.19%), Postives = 53/64 (82.81%), Query Frame = 1 Query: 1 MHLMYYLDESGKRVYTLQKMDPQGGQTLSAHPARFSPDDQFSKQRINNKLRYGLLPTQQPKVQL 192 M+LMYYLD+SG RVY+L+K P G TLSAHPARFSPDD+FSK+R+ K R+G+LPTQQP +L Sbjct: 1 MYLMYYLDDSGNRVYSLKKSTPDGSPTLSAHPARFSPDDKFSKERVTIKKRFGILPTQQPAPEL 64
BLAST of mRNA_P-wetherbeei_contig1214.2.1 vs. uniprot
Match: A0A0L0HHH4_SPIPD (H/ACA ribonucleoprotein complex subunit NOP10 n=2 Tax=Spizellomyces TaxID=4815 RepID=A0A0L0HHH4_SPIPD) HSP 1 Score: 96.3 bits (238), Expect = 3.170e-24 Identity = 43/59 (72.88%), Postives = 51/59 (86.44%), Query Frame = 1 Query: 1 MHLMYYLDESGKRVYTLQKMDPQGGQTLSAHPARFSPDDQFSKQRINNKLRYGLLPTQQ 177 MHLMYYLDESGKRVYTL+K+ P+G T SAHPARFSPDD++S+ R+ K R+GLLPTQQ Sbjct: 1 MHLMYYLDESGKRVYTLKKLTPEGSVTKSAHPARFSPDDKYSRHRVTLKRRFGLLPTQQ 59
BLAST of mRNA_P-wetherbeei_contig1214.2.1 vs. uniprot
Match: K3WVP2_GLOUD (Nucleolar protein 10 n=3 Tax=Pythiaceae TaxID=4782 RepID=K3WVP2_GLOUD) HSP 1 Score: 95.5 bits (236), Expect = 6.390e-24 Identity = 45/60 (75.00%), Postives = 49/60 (81.67%), Query Frame = 1 Query: 1 MHLMYYLDESGKRVYTLQKMDPQGGQTLSAHPARFSPDDQFSKQRINNKLRYGLLPTQQP 180 MHLMYYL E GKRVYTL+K DP G T SAHPARFSPDD+FSK+RI K R+GLLPTQ P Sbjct: 1 MHLMYYLGEDGKRVYTLKKEDPSGKPTHSAHPARFSPDDKFSKERIITKKRFGLLPTQTP 60
BLAST of mRNA_P-wetherbeei_contig1214.2.1 vs. uniprot
Match: K8F2J5_9CHLO (Nucleolar protein 10 n=1 Tax=Bathycoccus prasinos TaxID=41875 RepID=K8F2J5_9CHLO) HSP 1 Score: 94.7 bits (234), Expect = 1.260e-23 Identity = 45/63 (71.43%), Postives = 52/63 (82.54%), Query Frame = 1 Query: 1 MHLMYYLDESGKRVYTLQKMDPQGGQTLSAHPARFSPDDQFSKQRINNKLRYGLLPTQQPKVQ 189 M+LMYYL+E GKRVYTL+K P G TLSAHPARFSPDD+FSKQR+ K R+GLL TQQP+ Q Sbjct: 1 MYLMYYLNEDGKRVYTLKKTGPDGKPTLSAHPARFSPDDKFSKQRVACKKRFGLLLTQQPEKQ 63
BLAST of mRNA_P-wetherbeei_contig1214.2.1 vs. uniprot
Match: A0A836CEE6_9STRA (Nucleolar protein 10 n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CEE6_9STRA) HSP 1 Score: 94.7 bits (234), Expect = 1.260e-23 Identity = 43/64 (67.19%), Postives = 51/64 (79.69%), Query Frame = 1 Query: 1 MHLMYYLDESGKRVYTLQKMDPQGGQTLSAHPARFSPDDQFSKQRINNKLRYGLLPTQQPKVQL 192 MHLMYY+ E GKRVYTL+K DP G T+SAHPARFSPDD+FS QR+ NK R+G+L TQ P +L Sbjct: 1 MHLMYYMGEDGKRVYTLKKEDPTGSPTVSAHPARFSPDDKFSHQRVVNKKRFGILLTQSPAPEL 64
BLAST of mRNA_P-wetherbeei_contig1214.2.1 vs. uniprot
Match: F0WPK8_9STRA (Nucleolar protein 10 n=2 Tax=Albugo TaxID=65356 RepID=F0WPK8_9STRA) HSP 1 Score: 94.7 bits (234), Expect = 1.260e-23 Identity = 45/64 (70.31%), Postives = 50/64 (78.12%), Query Frame = 1 Query: 1 MHLMYYLDESGKRVYTLQKMDPQGGQTLSAHPARFSPDDQFSKQRINNKLRYGLLPTQQPKVQL 192 MHLMYY+ GKRVYTLQKMD +G T SAHPARFSPDD+FSK+RI K R+GLLPTQ P L Sbjct: 1 MHLMYYIGSDGKRVYTLQKMDVEGTPTQSAHPARFSPDDKFSKERIICKKRFGLLPTQSPDTLL 64 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1214.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1214.2.1 >prot_P-wetherbeei_contig1214.2.1 ID=prot_P-wetherbeei_contig1214.2.1|Name=mRNA_P-wetherbeei_contig1214.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=65bp MHLMYYLDESGKRVYTLQKMDPQGGQTLSAHPARFSPDDQFSKQRINNKLback to top mRNA from alignment at P-wetherbeei_contig1214:1094..1549- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1214.2.1 ID=mRNA_P-wetherbeei_contig1214.2.1|Name=mRNA_P-wetherbeei_contig1214.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=456bp|location=Sequence derived from alignment at P-wetherbeei_contig1214:1094..1549- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1214:1094..1549- >mRNA_P-wetherbeei_contig1214.2.1 ID=mRNA_P-wetherbeei_contig1214.2.1|Name=mRNA_P-wetherbeei_contig1214.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=195bp|location=Sequence derived from alignment at P-wetherbeei_contig1214:1094..1549- (Phaeothamnion wetherbeei SAG_119_79)back to top |