mRNA_P-wetherbeei_contig11711.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11711.1.1 vs. uniprot
Match: A0A6H5KGL2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KGL2_9PHAE) HSP 1 Score: 78.2 bits (191), Expect = 9.420e-12 Identity = 40/76 (52.63%), Postives = 52/76 (68.42%), Query Frame = 1 Query: 133 GETLAARILFVSNGLCGHVEPLLRLAEEVASRGYDVTFATHDVAAPLVEMTPRVRFLSAGAMPQTPKALQETVRAI 360 G + RILFVS G GH PLL LAEE+A+RG++VTFATH+ P+V+ TP V FLSAG MP L+ +R++ Sbjct: 59 GRPVPGRILFVSVGFYGHAMPLLSLAEEIAARGHNVTFATHNCLRPMVDETPGVAFLSAGRMPMHDHHLRSKLRSL 134
BLAST of mRNA_P-wetherbeei_contig11711.1.1 vs. uniprot
Match: A0A067C9X2_SAPPC (Uncharacterized protein n=2 Tax=Saprolegnia TaxID=4769 RepID=A0A067C9X2_SAPPC) HSP 1 Score: 61.2 bits (147), Expect = 1.840e-6 Identity = 32/69 (46.38%), Postives = 46/69 (66.67%), Query Frame = 1 Query: 154 ILFVSNGLCGHVEPLLRLAEEVASRGYDVTFATHDVAAPLVEMTPRVRFLSAGAMPQTPKALQETVRAI 360 +LF+S + GH PLLR+A+E+ RGY+V+FATHD V+ T F+SAG P + AL+E ++AI Sbjct: 52 VLFISLAIRGHATPLLRVADEMVRRGYNVSFATHDSGKEWVQRT-GATFISAGPFPISADALREKLQAI 119
BLAST of mRNA_P-wetherbeei_contig11711.1.1 vs. uniprot
Match: A0A1V9YXK0_9STRA (Uncharacterized protein n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1V9YXK0_9STRA) HSP 1 Score: 60.1 bits (144), Expect = 4.330e-6 Identity = 31/69 (44.93%), Postives = 46/69 (66.67%), Query Frame = 1 Query: 154 ILFVSNGLCGHVEPLLRLAEEVASRGYDVTFATHDVAAPLVEMTPRVRFLSAGAMPQTPKALQETVRAI 360 ++F+S + GH PLLR+AEE+ RGY+V+FATHD V+ T F+SAGA P + AL+ +++I Sbjct: 47 VMFISLAIRGHATPLLRIAEEMVQRGYNVSFATHDSGKEWVQRT-GAHFVSAGAFPISADALRIKLQSI 114
BLAST of mRNA_P-wetherbeei_contig11711.1.1 vs. uniprot
Match: A0A1V9ZKP0_9STRA (Uncharacterized protein n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9ZKP0_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 9.370e-5 Identity = 29/69 (42.03%), Postives = 44/69 (63.77%), Query Frame = 1 Query: 154 ILFVSNGLCGHVEPLLRLAEEVASRGYDVTFATHDVAAPLVEMTPRVRFLSAGAMPQTPKALQETVRAI 360 +LF+S + GH PLLR+A+E+ RGY+V+FATH+ V T F+SAG P + L+E +++I Sbjct: 48 VLFISLAIRGHATPLLRVADEMVRRGYNVSFATHESGKEWVART-GAHFVSAGEFPISADGLREKLQSI 115 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11711.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11711.1.1 >prot_P-wetherbeei_contig11711.1.1 ID=prot_P-wetherbeei_contig11711.1.1|Name=mRNA_P-wetherbeei_contig11711.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=122bp SASTLEASEPWLRSTASPAGPNGRCPRPPDSNAAGGAASDGAGAGETLAAback to top mRNA from alignment at P-wetherbeei_contig11711:397..1634- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11711.1.1 ID=mRNA_P-wetherbeei_contig11711.1.1|Name=mRNA_P-wetherbeei_contig11711.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=1238bp|location=Sequence derived from alignment at P-wetherbeei_contig11711:397..1634- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11711:397..1634- >mRNA_P-wetherbeei_contig11711.1.1 ID=mRNA_P-wetherbeei_contig11711.1.1|Name=mRNA_P-wetherbeei_contig11711.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=366bp|location=Sequence derived from alignment at P-wetherbeei_contig11711:397..1634- (Phaeothamnion wetherbeei SAG_119_79)back to top |