mRNA_P-wetherbeei_contig11430.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11430.2.1 vs. uniprot
Match: A0A523P5U5_9PROT (Cytochrom_C_asm domain-containing protein n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A523P5U5_9PROT) HSP 1 Score: 86.3 bits (212), Expect = 4.580e-19 Identity = 40/56 (71.43%), Postives = 50/56 (89.29%), Query Frame = 1 Query: 1 IVFSALAWTTFAVLLVGRYQWHWRGRRAVKFLIAGFVLLALGFFGSKFVLELVLHR 168 IVFS LAW FA+L+VGR+++ WRGRRA+K++I GFVLLALGFFG+K VLEL+LHR Sbjct: 212 IVFSLLAWGVFAILIVGRWRFGWRGRRAIKYVIFGFVLLALGFFGTKVVLELILHR 267
BLAST of mRNA_P-wetherbeei_contig11430.2.1 vs. uniprot
Match: A0A3D5DI17_9GAMM (Phosphohydrolase n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A3D5DI17_9GAMM) HSP 1 Score: 81.3 bits (199), Expect = 3.650e-17 Identity = 38/56 (67.86%), Postives = 47/56 (83.93%), Query Frame = 1 Query: 1 IVFSALAWTTFAVLLVGRYQWHWRGRRAVKFLIAGFVLLALGFFGSKFVLELVLHR 168 I FSA+AW FA LL GR+++ WRGRRA+K++++GF LALGFFGSK VLELVLHR Sbjct: 212 ITFSAIAWGVFATLLYGRWRFGWRGRRAIKYVLSGFTSLALGFFGSKAVLELVLHR 267
BLAST of mRNA_P-wetherbeei_contig11430.2.1 vs. uniprot
Match: A0A3M1DM00_9GAMM (Cytochrom_C_asm domain-containing protein (Fragment) n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A3M1DM00_9GAMM) HSP 1 Score: 76.3 bits (186), Expect = 1.830e-15 Identity = 36/55 (65.45%), Postives = 44/55 (80.00%), Query Frame = 1 Query: 4 VFSALAWTTFAVLLVGRYQWHWRGRRAVKFLIAGFVLLALGFFGSKFVLELVLHR 168 V S +AW FAVLL GR+Q WRGR A+++ +AGF+LL LG+FGSK VLELVLHR Sbjct: 181 VLSMIAWVVFAVLLWGRWQRGWRGRLAIRYTLAGFILLMLGYFGSKVVLELVLHR 235
BLAST of mRNA_P-wetherbeei_contig11430.2.1 vs. uniprot
Match: A0A1F6VEP1_9PROT (Cytochrom_C_asm domain-containing protein n=1 Tax=Candidatus Muproteobacteria bacterium RBG_16_60_9 TaxID=1817755 RepID=A0A1F6VEP1_9PROT) HSP 1 Score: 76.6 bits (187), Expect = 2.090e-15 Identity = 33/56 (58.93%), Postives = 46/56 (82.14%), Query Frame = 1 Query: 1 IVFSALAWTTFAVLLVGRYQWHWRGRRAVKFLIAGFVLLALGFFGSKFVLELVLHR 168 +V +ALAW + VLL+GR+++ WRGR A+++ + GF LL LG+FGSKFVLE+VLHR Sbjct: 215 VVLAALAWVVYGVLLIGRWRFGWRGRTAIRWTLGGFALLLLGYFGSKFVLEVVLHR 270
BLAST of mRNA_P-wetherbeei_contig11430.2.1 vs. uniprot
Match: UPI00198499AB (Cytochrome c biogenesis protein CcsA n=2 Tax=Burkholderiales TaxID=80840 RepID=UPI00198499AB) HSP 1 Score: 75.5 bits (184), Expect = 6.650e-15 Identity = 34/55 (61.82%), Postives = 45/55 (81.82%), Query Frame = 1 Query: 4 VFSALAWTTFAVLLVGRYQWHWRGRRAVKFLIAGFVLLALGFFGSKFVLELVLHR 168 +FS L+W FA+LLVGRYQ+ WRGR+AV++L AG LL L + GS+FV+E+VLHR Sbjct: 226 IFSVLSWLVFAILLVGRYQFGWRGRQAVRWLYAGSTLLLLAYVGSRFVMEVVLHR 280
BLAST of mRNA_P-wetherbeei_contig11430.2.1 vs. uniprot
Match: A0A1B2LWT7_9GAMM (Cytochrome C assembly protein n=1 Tax=Acinetobacter larvae TaxID=1789224 RepID=A0A1B2LWT7_9GAMM) HSP 1 Score: 74.3 bits (181), Expect = 1.560e-14 Identity = 31/54 (57.41%), Postives = 45/54 (83.33%), Query Frame = 1 Query: 7 FSALAWTTFAVLLVGRYQWHWRGRRAVKFLIAGFVLLALGFFGSKFVLELVLHR 168 FS ++W + LL+G Y++ WRG++A++F I GF+LLALGFFGSKFVL+L+L+R Sbjct: 218 FSIISWFVYGALLIGHYKFGWRGQKAIRFTITGFLLLALGFFGSKFVLQLILNR 271
BLAST of mRNA_P-wetherbeei_contig11430.2.1 vs. uniprot
Match: A0A0A0DL54_9BURK (Cytochrom_C_asm domain-containing protein n=1 Tax=Aquabacterium sp. NJ1 TaxID=1538295 RepID=A0A0A0DL54_9BURK) HSP 1 Score: 74.3 bits (181), Expect = 1.850e-14 Identity = 34/56 (60.71%), Postives = 46/56 (82.14%), Query Frame = 1 Query: 4 VFSALAWTTFAVLLVGRYQWHWRGRRAVKFLIAGFVLLALGFFGSKFVLELVLHRA 171 +FS L+W FAVLL+GR ++ WRGR+AV++L+AG LL L + GS+FVLE+VLHRA Sbjct: 229 IFSVLSWLVFAVLLIGRARFGWRGRQAVRWLVAGSALLLLAYVGSRFVLEVVLHRA 284
BLAST of mRNA_P-wetherbeei_contig11430.2.1 vs. uniprot
Match: UPI000F07646A (cytochrome c biogenesis protein CcsA n=1 Tax=Acinetobacter TaxID=469 RepID=UPI000F07646A) HSP 1 Score: 73.9 bits (180), Expect = 2.130e-14 Identity = 32/55 (58.18%), Postives = 44/55 (80.00%), Query Frame = 1 Query: 4 VFSALAWTTFAVLLVGRYQWHWRGRRAVKFLIAGFVLLALGFFGSKFVLELVLHR 168 VFS ++W +AVLL+G Y + WRG++A++F + GF LLALGF GSKFVLE++L R Sbjct: 215 VFSLMSWLVYAVLLIGHYAFGWRGQKAIRFTLIGFALLALGFIGSKFVLEMILAR 269
BLAST of mRNA_P-wetherbeei_contig11430.2.1 vs. uniprot
Match: A0A519FQ10_9BURK (Cytochrome C assembly protein n=1 Tax=Rubrivivax sp. TaxID=50259 RepID=A0A519FQ10_9BURK) HSP 1 Score: 73.9 bits (180), Expect = 2.580e-14 Identity = 33/55 (60.00%), Postives = 45/55 (81.82%), Query Frame = 1 Query: 4 VFSALAWTTFAVLLVGRYQWHWRGRRAVKFLIAGFVLLALGFFGSKFVLELVLHR 168 VFS L+W FA+LL+GRY++ WRGR+AV++L AG LL L + GS+FV+E+VLHR Sbjct: 229 VFSVLSWLVFAILLIGRYRFGWRGRQAVRWLYAGSTLLLLAYVGSRFVMEVVLHR 283
BLAST of mRNA_P-wetherbeei_contig11430.2.1 vs. uniprot
Match: A0A7W1L4P5_9PROT (Cytochrome c biogenesis protein CcsA n=1 Tax=Betaproteobacteria bacterium TaxID=1891241 RepID=A0A7W1L4P5_9PROT) HSP 1 Score: 73.6 bits (179), Expect = 2.830e-14 Identity = 32/55 (58.18%), Postives = 46/55 (83.64%), Query Frame = 1 Query: 4 VFSALAWTTFAVLLVGRYQWHWRGRRAVKFLIAGFVLLALGFFGSKFVLELVLHR 168 +FS L W TFA+LL+GR+++ WRGRRA+++++AG VLL LG+ GSKFV E++L R Sbjct: 211 LFSVLGWLTFAILLIGRWRYGWRGRRALRWIVAGTVLLVLGYLGSKFVSEILLGR 265 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11430.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11430.2.1 >prot_P-wetherbeei_contig11430.2.1 ID=prot_P-wetherbeei_contig11430.2.1|Name=mRNA_P-wetherbeei_contig11430.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=58bp IVFSALAWTTFAVLLVGRYQWHWRGRRAVKFLIAGFVLLALGFFGSKFVLback to top mRNA from alignment at P-wetherbeei_contig11430:1981..2154- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11430.2.1 ID=mRNA_P-wetherbeei_contig11430.2.1|Name=mRNA_P-wetherbeei_contig11430.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=174bp|location=Sequence derived from alignment at P-wetherbeei_contig11430:1981..2154- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11430:1981..2154- >mRNA_P-wetherbeei_contig11430.2.1 ID=mRNA_P-wetherbeei_contig11430.2.1|Name=mRNA_P-wetherbeei_contig11430.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=174bp|location=Sequence derived from alignment at P-wetherbeei_contig11430:1981..2154- (Phaeothamnion wetherbeei SAG_119_79)back to top |