mRNA_P-wetherbeei_contig1140.4.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1140.4.1 vs. uniprot
Match: D7FPE7_ECTSI (Intraflagellar transport protein 74 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FPE7_ECTSI) HSP 1 Score: 61.2 bits (147), Expect = 5.840e-10 Identity = 30/53 (56.60%), Postives = 45/53 (84.91%), Query Frame = 1 Query: 25 QDESSFKEKQLRSSETTMKRLQQEREKRQQELERINSLDQKIPPEIQALKDRI 183 +DE SFK+KQL+SSE TM+RL Q++EKR QE+E++ +LD+KIP E+ LK+++ Sbjct: 2 EDEKSFKDKQLKSSEATMRRLHQDKEKRLQEMEKVKTLDEKIPLELNNLKEKM 54
BLAST of mRNA_P-wetherbeei_contig1140.4.1 vs. uniprot
Match: A0A6V2XWW9_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A6V2XWW9_HETAK) HSP 1 Score: 57.4 bits (137), Expect = 5.050e-8 Identity = 30/52 (57.69%), Postives = 42/52 (80.77%), Query Frame = 1 Query: 28 DESSFKEKQLRSSETTMKRLQQEREKRQQELERINSLDQKIPPEIQALKDRI 183 DE+ FKEKQL +S+ TM RL+QE+EKR QE+E+IN+LD KI E++ L D++ Sbjct: 421 DEARFKEKQLETSQMTMARLRQEKEKRLQEMEKINTLDDKIAEELRGLNDQM 472
BLAST of mRNA_P-wetherbeei_contig1140.4.1 vs. uniprot
Match: A0A2R5GD01_9STRA (Intraflagellar transport protein 74-like n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5GD01_9STRA) HSP 1 Score: 50.1 bits (118), Expect = 1.940e-5 Identity = 27/52 (51.92%), Postives = 43/52 (82.69%), Query Frame = 1 Query: 28 DESSFKEKQLRSSETTMKRLQQEREKRQQELERINSLDQKIPPEIQALKDRI 183 D +FK++QL SS +TM++L++E EKR+ ELE+IN+LD+KI E+++L +RI Sbjct: 406 DALTFKKRQLESSASTMEQLEKELEKRRGELEKINTLDEKIEVELKSLTERI 457 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1140.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1140.4.1 >prot_P-wetherbeei_contig1140.4.1 ID=prot_P-wetherbeei_contig1140.4.1|Name=mRNA_P-wetherbeei_contig1140.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=65bp TAVRRAAWQDESSFKEKQLRSSETTMKRLQQEREKRQQELERINSLDQKIback to top mRNA from alignment at P-wetherbeei_contig1140:7459..7653- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1140.4.1 ID=mRNA_P-wetherbeei_contig1140.4.1|Name=mRNA_P-wetherbeei_contig1140.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=195bp|location=Sequence derived from alignment at P-wetherbeei_contig1140:7459..7653- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1140:7459..7653- >mRNA_P-wetherbeei_contig1140.4.1 ID=mRNA_P-wetherbeei_contig1140.4.1|Name=mRNA_P-wetherbeei_contig1140.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=195bp|location=Sequence derived from alignment at P-wetherbeei_contig1140:7459..7653- (Phaeothamnion wetherbeei SAG_119_79)back to top |