mRNA_P-wetherbeei_contig11394.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11394.1.1 vs. uniprot
Match: C1ECH4_MICCC (MYND-type domain-containing protein n=1 Tax=Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709) TaxID=296587 RepID=C1ECH4_MICCC) HSP 1 Score: 58.9 bits (141), Expect = 1.430e-8 Identity = 26/43 (60.47%), Postives = 35/43 (81.40%), Query Frame = 1 Query: 1 CSCCGRDEQPNVK-LLQCGACKTTKYCSKQCQVDHWKSHKAQC 126 CS CG ++P+ K LL+CG CKTT+YCSK+CQV+ W +HKA+C Sbjct: 3 CSGCGAAKRPDGKSLLRCGKCKTTQYCSKECQVNMWPTHKAEC 45
BLAST of mRNA_P-wetherbeei_contig11394.1.1 vs. uniprot
Match: A0A146HWG5_MYCCL (MYND-type domain-containing protein n=2 Tax=Mycena chlorophos TaxID=658473 RepID=A0A146HWG5_MYCCL) HSP 1 Score: 57.8 bits (138), Expect = 3.000e-8 Identity = 24/43 (55.81%), Postives = 27/43 (62.79%), Query Frame = 1 Query: 1 CSCCGRDEQPNVKLLQCGACKTTKYCSKQCQVDHWKSHKAQCK 129 CS C V L CG C+ T+YCSK CQVDHWK+HK CK Sbjct: 33 CSQCAASSSATVTLKLCGGCQLTRYCSKSCQVDHWKTHKLSCK 75
BLAST of mRNA_P-wetherbeei_contig11394.1.1 vs. uniprot
Match: A0A0C2X867_AMAMK (MYND-type domain-containing protein n=1 Tax=Amanita muscaria (strain Koide BX008) TaxID=946122 RepID=A0A0C2X867_AMAMK) HSP 1 Score: 57.8 bits (138), Expect = 3.750e-8 Identity = 26/44 (59.09%), Postives = 30/44 (68.18%), Query Frame = 1 Query: 4 SCCGRDEQPNVKLLQCGACKTTKYCSKQCQVDHWKSHKAQCKEA 135 +C D KLL CGACKTTKYCS +CQ + WKSHK QCK + Sbjct: 1129 ACARCDGAGKPKLLLCGACKTTKYCSAECQKEDWKSHKKQCKRS 1172
BLAST of mRNA_P-wetherbeei_contig11394.1.1 vs. uniprot
Match: A0A0C9SX59_PLICR (MYND-type domain-containing protein n=1 Tax=Plicaturopsis crispa FD-325 SS-3 TaxID=944288 RepID=A0A0C9SX59_PLICR) HSP 1 Score: 56.6 bits (135), Expect = 4.150e-8 Identity = 26/55 (47.27%), Postives = 38/55 (69.09%), Query Frame = 1 Query: 1 CSCCGRDEQPNVKLLQCGACKTTKYCSKQCQVDHWKSHKAQCKEARRGSTGSAGS 165 C+ C +++ + L QC CK+T YCSK+CQV HW SHK+QC+ G++GS+ S Sbjct: 8 CAKCAKEDSLS-HLSQCSRCKSTTYCSKECQVAHWPSHKSQCRSGATGASGSSSS 61
BLAST of mRNA_P-wetherbeei_contig11394.1.1 vs. uniprot
Match: A0A6A5YE51_9PLEO (MYND-type zinc finger protein samB n=1 Tax=Lophiotrema nucula TaxID=690887 RepID=A0A6A5YE51_9PLEO) HSP 1 Score: 57.0 bits (136), Expect = 6.080e-8 Identity = 25/43 (58.14%), Postives = 28/43 (65.12%), Query Frame = 1 Query: 1 CSCCGRDEQPNVKLLQCGACKTTKYCSKQCQVDHWKSHKAQCK 129 C+ C E+ KLL CG CK KYCSK CQ HWK+HKA CK Sbjct: 233 CATCRAGEKAGSKLLVCGGCKDRKYCSKDCQKKHWKTHKAFCK 275
BLAST of mRNA_P-wetherbeei_contig11394.1.1 vs. uniprot
Match: A0A8J9VW59_BRALA (Hypp739 protein n=1 Tax=Branchiostoma lanceolatum TaxID=7740 RepID=A0A8J9VW59_BRALA) HSP 1 Score: 56.6 bits (135), Expect = 9.480e-8 Identity = 24/45 (53.33%), Postives = 29/45 (64.44%), Query Frame = 1 Query: 1 CSCCGRDEQPNVKLLQCGACKTTKYCSKQCQVDHWKS-HKAQCKE 132 C C R E P K +CG C+ T+YCSKQCQ HW+ HK +CKE Sbjct: 641 CGFCNRQELPEAKFQKCGRCRKTRYCSKQCQHQHWRGGHKDECKE 685
BLAST of mRNA_P-wetherbeei_contig11394.1.1 vs. uniprot
Match: D8Q889_SCHCM (MYND-type domain-containing protein n=1 Tax=Schizophyllum commune (strain H4-8 / FGSC 9210) TaxID=578458 RepID=D8Q889_SCHCM) HSP 1 Score: 55.5 bits (132), Expect = 1.570e-7 Identity = 23/35 (65.71%), Postives = 26/35 (74.29%), Query Frame = 1 Query: 25 QPNVKLLQCGACKTTKYCSKQCQVDHWKSHKAQCK 129 Q VKLL C CK + YCS++CQV HW SHKAQCK Sbjct: 22 QTEVKLLSCSKCKLSHYCSRECQVAHWPSHKAQCK 56
BLAST of mRNA_P-wetherbeei_contig11394.1.1 vs. uniprot
Match: A0A8K1CBX8_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1CBX8_PYTOL) HSP 1 Score: 55.5 bits (132), Expect = 2.400e-7 Identity = 21/39 (53.85%), Postives = 29/39 (74.36%), Query Frame = 1 Query: 22 EQPNVKLLQCGACKTTKYCSKQCQVDHWKSHKAQCKEAR 138 + P+ KL++CG C+TT+YCS+QCQ WK HK +CK R Sbjct: 313 DNPDGKLMKCGGCRTTQYCSRQCQKKAWKEHKTECKRIR 351
BLAST of mRNA_P-wetherbeei_contig11394.1.1 vs. uniprot
Match: UPI000644BAD2 (hypothetical protein n=1 Tax=Acytostelium subglobosum LB1 TaxID=1410327 RepID=UPI000644BAD2) HSP 1 Score: 55.5 bits (132), Expect = 2.430e-7 Identity = 26/44 (59.09%), Postives = 30/44 (68.18%), Query Frame = 1 Query: 1 CSCCGRDEQPNVKLLQCGACKTTKYCSKQCQVDHWKSHKAQCKE 132 CSCC +Q VK L CG CKT YCSKQCQ +HW +HK CK+ Sbjct: 757 CSCC---KQTLVKPLICGYCKTVAYCSKQCQHEHWVTHKDSCKQ 797
BLAST of mRNA_P-wetherbeei_contig11394.1.1 vs. uniprot
Match: A0A1Y1I782_KLENI (Uncharacterized protein n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1I782_KLENI) HSP 1 Score: 55.1 bits (131), Expect = 3.270e-7 Identity = 21/41 (51.22%), Postives = 27/41 (65.85%), Query Frame = 1 Query: 10 CGRDEQPNVKLLQCGACKTTKYCSKQCQVDHWKSHKAQCKE 132 CG+DE K +C AC +YCS+ CQ+ HWK+HK CKE Sbjct: 396 CGKDEATAGKFKRCNACAKARYCSRDCQLQHWKAHKKDCKE 436 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11394.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11394.1.1 >prot_P-wetherbeei_contig11394.1.1 ID=prot_P-wetherbeei_contig11394.1.1|Name=mRNA_P-wetherbeei_contig11394.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=65bp CSCCGRDEQPNVKLLQCGACKTTKYCSKQCQVDHWKSHKAQCKEARRGSTback to top mRNA from alignment at P-wetherbeei_contig11394:3..582+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11394.1.1 ID=mRNA_P-wetherbeei_contig11394.1.1|Name=mRNA_P-wetherbeei_contig11394.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=580bp|location=Sequence derived from alignment at P-wetherbeei_contig11394:3..582+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11394:3..582+ >mRNA_P-wetherbeei_contig11394.1.1 ID=mRNA_P-wetherbeei_contig11394.1.1|Name=mRNA_P-wetherbeei_contig11394.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=195bp|location=Sequence derived from alignment at P-wetherbeei_contig11394:3..582+ (Phaeothamnion wetherbeei SAG_119_79)back to top |