mRNA_P-wetherbeei_contig1133.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1133.1.1 vs. uniprot
Match: A0A835YM39_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YM39_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 4.980e-5 Identity = 37/80 (46.25%), Postives = 45/80 (56.25%), Query Frame = 2 Query: 497 TSGSAGLLPLNWVASSRRADLAVSLLSALIQQVGRPAAEEHLLGGMYKQKELQRLARCLGRQIYGGGRRYTNKELVTSVM 736 T+ SAG LP +A SLL A + G A E L G KQ LQ +AR L QIYGGGRR+TN+EL +SV+ Sbjct: 249 TAASAGPLP--------DPAMARSLLRAAVDLRGFAATEASLASGHLKQTLLQGVARALSCQIYGGGRRFTNRELASSVL 320 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1133.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1133.1.1 >prot_P-wetherbeei_contig1133.1.1 ID=prot_P-wetherbeei_contig1133.1.1|Name=mRNA_P-wetherbeei_contig1133.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=186bp MNEIPEYAQGQPPFSDDDDDDEMPSAHKRARHGNAGGGASGEQGLMPNVNback to top mRNA from alignment at P-wetherbeei_contig1133:147..1299- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1133.1.1 ID=mRNA_P-wetherbeei_contig1133.1.1|Name=mRNA_P-wetherbeei_contig1133.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=1153bp|location=Sequence derived from alignment at P-wetherbeei_contig1133:147..1299- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1133:147..1299- >mRNA_P-wetherbeei_contig1133.1.1 ID=mRNA_P-wetherbeei_contig1133.1.1|Name=mRNA_P-wetherbeei_contig1133.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=558bp|location=Sequence derived from alignment at P-wetherbeei_contig1133:147..1299- (Phaeothamnion wetherbeei SAG_119_79)back to top |