mRNA_P-wetherbeei_contig11311.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: W2PX75_PHYPN (Uncharacterized protein n=1 Tax=Phytophthora parasitica (strain INRA-310) TaxID=761204 RepID=W2PX75_PHYPN) HSP 1 Score: 53.1 bits (126), Expect = 1.640e-6 Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 2 Query: 53 QVSCTVTFDPATEGASLSHALDYFQYQVR 139 QVSCTVTFDP TEG+ L+H LDYFQYQ++ Sbjct: 48 QVSCTVTFDPKTEGSQLAHMLDYFQYQLK 76
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: A0A6H5KM58_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KM58_9PHAE) HSP 1 Score: 54.7 bits (130), Expect = 2.280e-6 Identity = 23/30 (76.67%), Postives = 27/30 (90.00%), Query Frame = 2 Query: 50 VQVSCTVTFDPATEGASLSHALDYFQYQVR 139 VQVSCT+TFDP TEG L+HALDYFQYQ++ Sbjct: 526 VQVSCTITFDPDTEGKHLAHALDYFQYQLK 555
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: A0A1Y1Z8W3_9FUNG (Ribonucleoside-triphosphate reductase (thioredoxin) n=2 Tax=Basidiobolus meristosporus CBS 931.73 TaxID=1314790 RepID=A0A1Y1Z8W3_9FUNG) HSP 1 Score: 53.5 bits (127), Expect = 5.840e-6 Identity = 24/41 (58.54%), Postives = 30/41 (73.17%), Query Frame = 2 Query: 17 LTLYIPLWCGVVQVSCTVTFDPATEGASLSHALDYFQYQVR 139 LT ++ + QVSCTVTFDP TEG + HALDYFQYQ++ Sbjct: 589 LTSFLQRYWSDNQVSCTVTFDPETEGDQMKHALDYFQYQLK 629
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: D0MVF9_PHYIT (Ribonucleoside-triphosphate reductase (thioredoxin) n=2 Tax=Phytophthora infestans TaxID=4787 RepID=D0MVF9_PHYIT) HSP 1 Score: 53.1 bits (126), Expect = 7.930e-6 Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 2 Query: 53 QVSCTVTFDPATEGASLSHALDYFQYQVR 139 QVSCTVTFDP TEG+ L+H LDYFQYQ++ Sbjct: 574 QVSCTVTFDPKTEGSQLAHLLDYFQYQLK 602
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: A0A225VWJ8_9STRA (Ribonucleoside-triphosphate reductase (thioredoxin) n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225VWJ8_9STRA) HSP 1 Score: 53.1 bits (126), Expect = 7.980e-6 Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 2 Query: 53 QVSCTVTFDPATEGASLSHALDYFQYQVR 139 QVSCTVTFDP TEG+ L+H LDYFQYQ++ Sbjct: 616 QVSCTVTFDPKTEGSQLAHMLDYFQYQLK 644
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: D7FJK6_ECTSI (Ribonucleoside-triphosphate reductase (thioredoxin) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FJK6_ECTSI) HSP 1 Score: 53.1 bits (126), Expect = 7.980e-6 Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 2 Query: 53 QVSCTVTFDPATEGASLSHALDYFQYQVR 139 QVSCT+TFDP TEG L+HALDYFQYQ++ Sbjct: 611 QVSCTITFDPETEGHHLAHALDYFQYQLK 639
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: A0A7S3J8B8_9SPIT (Hypothetical protein (Fragment) n=1 Tax=Euplotes harpa TaxID=151035 RepID=A0A7S3J8B8_9SPIT) HSP 1 Score: 50.1 bits (118), Expect = 1.250e-5 Identity = 22/29 (75.86%), Postives = 25/29 (86.21%), Query Frame = 2 Query: 53 QVSCTVTFDPATEGASLSHALDYFQYQVR 139 QVSCTVTFDP TEG SL AL+YFQYQ++ Sbjct: 55 QVSCTVTFDPKTEGESLKPALEYFQYQLK 83
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: H3GD43_PHYRM (Ribonucleoside-triphosphate reductase (thioredoxin) n=4 Tax=Phytophthora TaxID=4783 RepID=H3GD43_PHYRM) HSP 1 Score: 52.4 bits (124), Expect = 1.470e-5 Identity = 22/29 (75.86%), Postives = 25/29 (86.21%), Query Frame = 2 Query: 53 QVSCTVTFDPATEGASLSHALDYFQYQVR 139 QVSCTVTFDP TEG L+H LDYFQYQ++ Sbjct: 538 QVSCTVTFDPKTEGLQLAHMLDYFQYQLK 566
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: A0A3R7GI44_9STRA (Ribonucleoside-triphosphate reductase (thioredoxin) n=4 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3R7GI44_9STRA) HSP 1 Score: 52.4 bits (124), Expect = 1.470e-5 Identity = 22/29 (75.86%), Postives = 25/29 (86.21%), Query Frame = 2 Query: 53 QVSCTVTFDPATEGASLSHALDYFQYQVR 139 QVSCTVTFDP TEG +SH LDYFQYQ++ Sbjct: 554 QVSCTVTFDPKTEGPHISHMLDYFQYQLK 582
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Match: A0A8J5M3B0_9STRA (Ribonucleoside-triphosphate reductase (thioredoxin) n=1 Tax=Phytophthora aleatoria TaxID=2496075 RepID=A0A8J5M3B0_9STRA) HSP 1 Score: 52.4 bits (124), Expect = 1.480e-5 Identity = 22/29 (75.86%), Postives = 25/29 (86.21%), Query Frame = 2 Query: 53 QVSCTVTFDPATEGASLSHALDYFQYQVR 139 QVSCTVTFDP TEG L+H LDYFQYQ++ Sbjct: 606 QVSCTVTFDPKTEGPQLAHMLDYFQYQLK 634 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11311.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11311.2.1 >prot_P-wetherbeei_contig11311.2.1 ID=prot_P-wetherbeei_contig11311.2.1|Name=mRNA_P-wetherbeei_contig11311.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=106bp MCRRLTLYIPLWCGVVQVSCTVTFDPATEGASLSHALDYFQYQVRCAERSback to top mRNA from alignment at P-wetherbeei_contig11311:1849..2175- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11311.2.1 ID=mRNA_P-wetherbeei_contig11311.2.1|Name=mRNA_P-wetherbeei_contig11311.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=327bp|location=Sequence derived from alignment at P-wetherbeei_contig11311:1849..2175- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11311:1849..2175- >mRNA_P-wetherbeei_contig11311.2.1 ID=mRNA_P-wetherbeei_contig11311.2.1|Name=mRNA_P-wetherbeei_contig11311.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=318bp|location=Sequence derived from alignment at P-wetherbeei_contig11311:1849..2175- (Phaeothamnion wetherbeei SAG_119_79)back to top |