mRNA_P-wetherbeei_contig1130.3.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1130.3.1 vs. uniprot
Match: A0A835ZA77_9STRA (Cathepsin B-like proteinase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZA77_9STRA) HSP 1 Score: 82.4 bits (202), Expect = 7.650e-13 Identity = 42/77 (54.55%), Postives = 48/77 (62.34%), Query Frame = 1 Query: 727 HHVDPQAAGLPVC-SPSEYLRPACVNKCFDATCGVPHAHDKRFASSTSKLSTVEEIQADLMEHGPVTAAFSVYEDFL 954 HHVDP A+G P C + +EY P C N C DA+ DKR+A L V IQ D+MEHGPVTAAFSVY DFL Sbjct: 380 HHVDPGASGYPECPAGAEYPTPKCENACTDASYNTVFDDDKRYAKDAYSLHGVANIQKDMMEHGPVTAAFSVYSDFL 456
BLAST of mRNA_P-wetherbeei_contig1130.3.1 vs. uniprot
Match: A0A6H5LCY9_9PHAE (Pept_C1 domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5LCY9_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 3.000e-10 Identity = 35/77 (45.45%), Postives = 48/77 (62.34%), Query Frame = 1 Query: 727 HHVDPQAAGLPVCSPSEYLRPACVNKCFDAT-CGVPHAHDKRFASSTSKLSTVEEIQADLMEHGPVTAAFSVYEDFL 954 HHVDP A+G P C EY P C+++C + G + DK+ A L+ +E IQ D+M++G VTAAFSV+ DFL Sbjct: 414 HHVDPGASGYPACPDGEYPTPECLSECSEINFSGGSYGEDKKMAREAYSLAGIENIQRDMMKYGSVTAAFSVFSDFL 490
BLAST of mRNA_P-wetherbeei_contig1130.3.1 vs. uniprot
Match: A0A2C9JPF7_BIOGL (Pept_C1 domain-containing protein n=1 Tax=Biomphalaria glabrata TaxID=6526 RepID=A0A2C9JPF7_BIOGL) HSP 1 Score: 65.5 bits (158), Expect = 8.720e-8 Identity = 35/80 (43.75%), Postives = 45/80 (56.25%), Query Frame = 1 Query: 715 PKMTHHVDPQAAGLPVCSPSEYLRPACVNKCFDATCGVPHAHDKRFASSTSKLSTVEEIQADLMEHGPVTAAFSVYEDFL 954 P HHV LP C P EY P C +C +++ +P+ DK F T +S E I +L+E+GPV AAFSVY DFL Sbjct: 192 PACEHHV---VGKLPPCGPEEYPTPECKKQC-ESSYKIPYKADKHFGVKTYTVSGEENIMQELIENGPVEAAFSVYSDFL 267
BLAST of mRNA_P-wetherbeei_contig1130.3.1 vs. uniprot
Match: CPR4_CAEEL (Cathepsin B-like cysteine proteinase 4 n=13 Tax=cellular organisms TaxID=131567 RepID=CPR4_CAEEL) HSP 1 Score: 61.6 bits (148), Expect = 1.510e-6 Identity = 31/66 (46.97%), Postives = 40/66 (60.61%), Query Frame = 1 Query: 757 PVCSPSEYLRPACVNKCFDATCGVPHAHDKRFASSTSKLST-VEEIQADLMEHGPVTAAFSVYEDF 951 P C Y PACVNKC + V + DK F S+ + V +IQA+++ HGPV AAF+VYEDF Sbjct: 197 PSCPDDGYDTPACVNKCTNKNYNVAYTADKHFGSTAYAVGKKVSQIQAEIIAHGPVEAAFTVYEDF 262
BLAST of mRNA_P-wetherbeei_contig1130.3.1 vs. uniprot
Match: A0A5A8C1L9_CAFRO (Pept_C1 domain-containing protein n=3 Tax=Sar TaxID=2698737 RepID=A0A5A8C1L9_CAFRO) HSP 1 Score: 60.8 bits (146), Expect = 2.740e-6 Identity = 36/80 (45.00%), Postives = 45/80 (56.25%), Query Frame = 1 Query: 715 PKMTHHVDPQAAGLPVCSPSEYLRPACVNKCFDATCGVPHAHDKRFASSTSKLSTVEEIQADLMEHGPVTAAFSVYEDFL 954 P HHV P C PAC ++C D VP+A DK A S L++V +IQ D+ ++G VTAAFSVYEDFL Sbjct: 194 PPCEHHVK---GPRPDCKEGG-ATPACTSQC-DTGYSVPYAKDKHMAKSVYSLNSVADIQQDIYQYGAVTAAFSVYEDFL 268
BLAST of mRNA_P-wetherbeei_contig1130.3.1 vs. uniprot
Match: W7TUA6_9STRA (Cathepsin b n=2 Tax=Monodopsidaceae TaxID=425072 RepID=W7TUA6_9STRA) HSP 1 Score: 61.2 bits (147), Expect = 3.480e-6 Identity = 33/77 (42.86%), Postives = 46/77 (59.74%), Query Frame = 1 Query: 727 HHVDPQAAGLPVCSPSEYLRPACVNKCFDATCGVPHAHDKRFAS-STSKLSTVEEIQADLMEHGPVTAAFSVYEDFL 954 HHV+P LP C ++ P C + C + ++ DKR A S + VEEIQ ++ME GPV+AAF+VY+DFL Sbjct: 345 HHVEPTEE-LPACPAEDFETPRCRHTCSEELYEETYSADKRMAKRGYSVRANVEEIQKEIMESGPVSAAFTVYQDFL 420
BLAST of mRNA_P-wetherbeei_contig1130.3.1 vs. uniprot
Match: UPI00192D4453 (hypothetical protein n=1 Tax=Acinetobacter pittii TaxID=48296 RepID=UPI00192D4453) HSP 1 Score: 57.8 bits (138), Expect = 4.100e-6 Identity = 32/80 (40.00%), Postives = 38/80 (47.50%), Query Frame = 1 Query: 715 PKMTHHVDPQAAGLPVCSP-SEYLRPACVNKCFDATCGVPHAHDKRFASSTSKLSTVEEIQADLMEHGPVTAAFSVYEDF 951 P HH + LP CS EY P C KC ++ VP D L VE+IQ D++ HGPV A F VY DF Sbjct: 20 PXCEHHTE---GSLPACSSLPEYDTPRCEKKCTNSQYXVPFKQDHHKVKKGYSLRGVEQIQRDILAHGPVEAGFDVYXDF 96
BLAST of mRNA_P-wetherbeei_contig1130.3.1 vs. uniprot
Match: A0A0B7AQF3_9EUPU (Pept_C1 domain-containing protein (Fragment) n=1 Tax=Arion vulgaris TaxID=1028688 RepID=A0A0B7AQF3_9EUPU) HSP 1 Score: 56.2 bits (134), Expect = 5.830e-5 Identity = 32/80 (40.00%), Postives = 41/80 (51.25%), Query Frame = 1 Query: 715 PKMTHHVDPQAAGLPVCSPSEYLRPACVNKCFDATCGVPHAHDKRFASSTSKLSTVEEIQADLMEHGPVTAAFSVYEDFL 954 P HH L C E P C N C D+ +P+A DK F T ++ E I +L+++GPV AAFSVY DFL Sbjct: 199 PACEHHT---TGHLQPCGGKEAETPECKNVCEDSY-KIPYAKDKHFGVKTYSVTGEENIMQELVQNGPVEAAFSVYSDFL 274
BLAST of mRNA_P-wetherbeei_contig1130.3.1 vs. uniprot
Match: A0A0G4G3C8_9ALVE (Pept_C1 domain-containing protein n=1 Tax=Chromera velia CCMP2878 TaxID=1169474 RepID=A0A0G4G3C8_9ALVE) HSP 1 Score: 57.0 bits (136), Expect = 6.400e-5 Identity = 31/80 (38.75%), Postives = 46/80 (57.50%), Query Frame = 1 Query: 715 PKMTHHVDPQAAGLPVCSPSEYLRPACVNKCFDATCGVPHAHDKRFASSTSKLSTVEEIQADLMEHGPVTAAFSVYEDFL 954 P +HH + + LP C + P+C + C + G DKR A+ + +V EI+ +L+ +GPVTAAF+VYEDFL Sbjct: 259 PMCSHHSESE---LPPCGETRPT-PSCRSSCSEEEFGSEFKADKRRATKAYSIGSVSEIKKELVNNGPVTAAFTVYEDFL 334 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1130.3.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 9
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1130.3.1 >prot_P-wetherbeei_contig1130.3.1 ID=prot_P-wetherbeei_contig1130.3.1|Name=mRNA_P-wetherbeei_contig1130.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=275bp MEDKVAAAAADGADEEEGFGSAISGIGDAVRVVGGAVIGIIGGPGVASVGback to top mRNA from alignment at P-wetherbeei_contig1130:5624..7820- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1130.3.1 ID=mRNA_P-wetherbeei_contig1130.3.1|Name=mRNA_P-wetherbeei_contig1130.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=2197bp|location=Sequence derived from alignment at P-wetherbeei_contig1130:5624..7820- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1130:5624..7820- >mRNA_P-wetherbeei_contig1130.3.1 ID=mRNA_P-wetherbeei_contig1130.3.1|Name=mRNA_P-wetherbeei_contig1130.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=825bp|location=Sequence derived from alignment at P-wetherbeei_contig1130:5624..7820- (Phaeothamnion wetherbeei SAG_119_79)back to top |