mRNA_P-wetherbeei_contig11293.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11293.1.1 vs. uniprot
Match: A0A836CL97_9STRA (Acyltransferase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CL97_9STRA) HSP 1 Score: 77.8 bits (190), Expect = 3.330e-15 Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 1 Query: 1 WCPMLPKPSRLNTVWGTPVVLPRIAEPTAAEIDKFHAAYVAALVALFDRHKARFAGNPTATLDV 192 WCP+LP PS +NTV+G P +P+I PT +I+K+HA YV L AL+DRHK +FA NP L+V Sbjct: 267 WCPLLPIPSNINTVFGKPFRVPQIDHPTPEDINKWHALYVQELKALYDRHKHQFASNPNQELEV 330
BLAST of mRNA_P-wetherbeei_contig11293.1.1 vs. uniprot
Match: A0A485KZD3_9STRA (Acyltransferase n=1 Tax=Aphanomyces stellatus TaxID=120398 RepID=A0A485KZD3_9STRA) HSP 1 Score: 75.5 bits (184), Expect = 1.260e-14 Identity = 35/65 (53.85%), Postives = 50/65 (76.92%), Query Frame = 1 Query: 1 WCPMLPKPS-RLNTVWGTPVVLPRIAEPTAAEIDKFHAAYVAALVALFDRHKARFAGNPTATLDV 192 WC +P S +L TV G P+ LP+IA+PT ++DK+HAAYVAAL +F+ HKA++A +P+ATL+V Sbjct: 252 WCMYMPFSSAKLVTVVGKPIELPQIAQPTKEDVDKYHAAYVAALTGIFESHKAKYASDPSATLEV 316
BLAST of mRNA_P-wetherbeei_contig11293.1.1 vs. uniprot
Match: D8LL52_ECTSI (Acyltransferase n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LL52_ECTSI) HSP 1 Score: 74.7 bits (182), Expect = 3.400e-14 Identity = 33/64 (51.56%), Postives = 46/64 (71.88%), Query Frame = 1 Query: 1 WCPMLPKPSRLNTVWGTPVVLPRIAEPTAAEIDKFHAAYVAALVALFDRHKARFAGNPTATLDV 192 WCP+LP+ +L TV+G P+ LP+I +P+ ++DK+HAAYV L AL RHKA++A NP L V Sbjct: 315 WCPLLPRRVKLMTVFGEPLALPKIEQPSPEDVDKWHAAYVEELKALHGRHKAKYASNPQLELKV 378
BLAST of mRNA_P-wetherbeei_contig11293.1.1 vs. uniprot
Match: A0A2D4BL94_PYTIN (Acyltransferase n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BL94_PYTIN) HSP 1 Score: 67.8 bits (164), Expect = 9.330e-12 Identity = 32/65 (49.23%), Postives = 48/65 (73.85%), Query Frame = 1 Query: 4 CPMLPKPS-RLNTVWGTPVVLPRIAEPTAAEIDKFHAAYVAALVALFDRHKARFAGNPTATLDVW 195 C ++P+P+ L TV G + LP+I +PT ++ K+HA Y+AAL ALF+R+KARFA NP A L+++ Sbjct: 277 CALMPRPNVDLVTVVGKGLQLPKIEQPTREDVSKYHAQYIAALEALFERYKARFASNPNAKLEIF 341
BLAST of mRNA_P-wetherbeei_contig11293.1.1 vs. uniprot
Match: A0A7S2N7I8_9DINO (Hypothetical protein n=1 Tax=Alexandrium andersonii TaxID=327968 RepID=A0A7S2N7I8_9DINO) HSP 1 Score: 63.2 bits (152), Expect = 1.970e-11 Identity = 35/63 (55.56%), Postives = 45/63 (71.43%), Query Frame = 1 Query: 7 PMLPKP-SRLNTVWGTPVVLPRIAEPTAAEIDKFHAAYVAALVALFDRHKARFAGNPTATLDV 192 P LP+P SRL T G + LP+IAEPTAAEID +H Y+ AL ALFD K+ AG P+A+L++ Sbjct: 37 PFLPRPESRLLTYVGPALALPKIAEPTAAEIDHWHGEYMKALTALFDEKKSE-AGYPSASLEI 98
BLAST of mRNA_P-wetherbeei_contig11293.1.1 vs. uniprot
Match: A0A067CBR8_SAPPC (Uncharacterized protein n=1 Tax=Saprolegnia parasitica (strain CBS 223.65) TaxID=695850 RepID=A0A067CBR8_SAPPC) HSP 1 Score: 62.8 bits (151), Expect = 3.140e-11 Identity = 31/66 (46.97%), Postives = 44/66 (66.67%), Query Frame = 1 Query: 1 WCPMLPKPSR-LNTVWGTPVVLPRIAEPTAAEIDKFHAAYVAALVALFDRHKARFAGNPTATLDVW 195 WC LP S+ + TV G P+ LP + PT ++ K+H AY+ AL ALF+RHKA +A +PT TL+ + Sbjct: 39 WCFFLPFASQTMTTVVGAPLQLPTLPSPTPDDVRKYHDAYMTALQALFERHKAAYAQDPTETLEFF 104
BLAST of mRNA_P-wetherbeei_contig11293.1.1 vs. uniprot
Match: A0A1V9Z344_9STRA (Acyltransferase n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9Z344_9STRA) HSP 1 Score: 64.3 bits (155), Expect = 1.470e-10 Identity = 33/65 (50.77%), Postives = 44/65 (67.69%), Query Frame = 1 Query: 1 WCPMLPKPS-RLNTVWGTPVVLPRIAEPTAAEIDKFHAAYVAALVALFDRHKARFAGNPTATLDV 192 +C LPK ++TV G P+VLP I P+ A++ K+H Y+ ALV LF+RHKA FA +P ATL V Sbjct: 244 FCFYLPKNDLAMHTVVGPPLVLPTIPTPSNADVQKYHQLYIDALVGLFNRHKAAFAADPNATLQV 308
BLAST of mRNA_P-wetherbeei_contig11293.1.1 vs. uniprot
Match: A0A8J2WZY3_9STRA (Nocturnin n=3 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A8J2WZY3_9STRA) HSP 1 Score: 64.3 bits (155), Expect = 1.900e-10 Identity = 30/55 (54.55%), Postives = 40/55 (72.73%), Query Frame = 1 Query: 1 WCPMLPKPS-RLNTVWGTPVVLPRIAEPTAAEIDKFHAAYVAALVALFDRHKARF 162 WCP+LP+ L+TV PV LP+IA PT ++++KFH AYV AL L+D HKA+F Sbjct: 576 WCPLLPRDDVALHTVVAEPVHLPKIANPTRSDVEKFHGAYVTALTRLYDTHKAQF 630
BLAST of mRNA_P-wetherbeei_contig11293.1.1 vs. uniprot
Match: A0A7S2HST2_9DINO (Hypothetical protein n=1 Tax=Brandtodinium nutricula TaxID=1333877 RepID=A0A7S2HST2_9DINO) HSP 1 Score: 63.5 bits (153), Expect = 2.310e-10 Identity = 30/65 (46.15%), Postives = 46/65 (70.77%), Query Frame = 1 Query: 1 WCPMLPKPS-RLNTVWGTPVVLPRIAEPTAAEIDKFHAAYVAALVALFDRHKARFAGNPTATLDV 192 WCP+LP+ LNTVWG + LPRI +PTAA+++++H Y+ A+ +FD HKA+F G + L++ Sbjct: 212 WCPILPRGDVPLNTVWGRVLELPRIEDPTAAQVEEWHKRYMTAVEEVFDAHKAQF-GYASRRLEI 275
BLAST of mRNA_P-wetherbeei_contig11293.1.1 vs. uniprot
Match: A0A067CCM1_SAPPC (Uncharacterized protein n=1 Tax=Saprolegnia parasitica (strain CBS 223.65) TaxID=695850 RepID=A0A067CCM1_SAPPC) HSP 1 Score: 62.8 bits (151), Expect = 4.890e-10 Identity = 31/66 (46.97%), Postives = 44/66 (66.67%), Query Frame = 1 Query: 1 WCPMLPKPSR-LNTVWGTPVVLPRIAEPTAAEIDKFHAAYVAALVALFDRHKARFAGNPTATLDVW 195 WC LP S+ + TV G P+ LP + PT ++ K+H AY+ AL ALF+RHKA +A +PT TL+ + Sbjct: 227 WCFFLPFASQTMTTVVGAPLQLPTLPSPTPDDVRKYHDAYMTALQALFERHKAAYAQDPTETLEFF 292 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11293.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11293.1.1 >prot_P-wetherbeei_contig11293.1.1 ID=prot_P-wetherbeei_contig11293.1.1|Name=mRNA_P-wetherbeei_contig11293.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=63bp MLPKPSRLNTVWGTPVVLPRIAEPTAAEIDKFHAAYVAALVALFDRHKARback to top mRNA from alignment at P-wetherbeei_contig11293:1839..2036- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11293.1.1 ID=mRNA_P-wetherbeei_contig11293.1.1|Name=mRNA_P-wetherbeei_contig11293.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=198bp|location=Sequence derived from alignment at P-wetherbeei_contig11293:1839..2036- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11293:1839..2036- >mRNA_P-wetherbeei_contig11293.1.1 ID=mRNA_P-wetherbeei_contig11293.1.1|Name=mRNA_P-wetherbeei_contig11293.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=189bp|location=Sequence derived from alignment at P-wetherbeei_contig11293:1839..2036- (Phaeothamnion wetherbeei SAG_119_79)back to top |