mRNA_P-wetherbeei_contig10985.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10985.1.1 vs. uniprot
Match: A0A6P5RNT9_PRUAV (Protein FAR1-RELATED SEQUENCE n=1 Tax=Prunus avium TaxID=42229 RepID=A0A6P5RNT9_PRUAV) HSP 1 Score: 49.3 bits (116), Expect = 9.800e-5 Identity = 27/86 (31.40%), Postives = 40/86 (46.51%), Query Frame = 1 Query: 16 LLRDDANNVIQWLQQIGDDGCRYARLLDGDHLTAVLWSTKEQREPAKLYGQVVIQDSTFGTNCFGLPFFVDVCVDDDGRLVLSLCA 273 L + NN + + GD D LT W+ R YG VV+ D+TF TN +GLPF + V++ G+ ++ CA Sbjct: 44 FLAEQKNNRSFYFKIEGDSN---------DRLTRCFWADATSRRAYGFYGDVVVLDTTFNTNRYGLPFAPMLGVNNHGQTIVLACA 120 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10985.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10985.1.1 >prot_P-wetherbeei_contig10985.1.1 ID=prot_P-wetherbeei_contig10985.1.1|Name=mRNA_P-wetherbeei_contig10985.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=96bp KAKKSLLRDDANNVIQWLQQIGDDGCRYARLLDGDHLTAVLWSTKEQREPback to top mRNA from alignment at P-wetherbeei_contig10985:1408..1695- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10985.1.1 ID=mRNA_P-wetherbeei_contig10985.1.1|Name=mRNA_P-wetherbeei_contig10985.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=288bp|location=Sequence derived from alignment at P-wetherbeei_contig10985:1408..1695- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10985:1408..1695- >mRNA_P-wetherbeei_contig10985.1.1 ID=mRNA_P-wetherbeei_contig10985.1.1|Name=mRNA_P-wetherbeei_contig10985.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=288bp|location=Sequence derived from alignment at P-wetherbeei_contig10985:1408..1695- (Phaeothamnion wetherbeei SAG_119_79)back to top |