mRNA_P-wetherbeei_contig1095.3.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1095.3.1 vs. uniprot
Match: W4GUY7_9STRA (Uncharacterized protein n=2 Tax=Aphanomyces astaci TaxID=112090 RepID=W4GUY7_9STRA) HSP 1 Score: 73.9 bits (180), Expect = 7.030e-15 Identity = 32/46 (69.57%), Postives = 38/46 (82.61%), Query Frame = 2 Query: 179 MCRKVTCSKCGKPSWAGCGQHIESALSGVAEADRCPGWRSGKCTAA 316 MCRK+ CS C KP+WAGCGQHI+SAL+ VA ADRCP W++GK AA Sbjct: 1 MCRKIDCSVCHKPTWAGCGQHIDSALANVAVADRCPSWQTGKHDAA 46
BLAST of mRNA_P-wetherbeei_contig1095.3.1 vs. uniprot
Match: A0A067CBU3_SAPPC (Uncharacterized protein n=2 Tax=Saprolegnia TaxID=4769 RepID=A0A067CBU3_SAPPC) HSP 1 Score: 72.4 bits (176), Expect = 2.740e-14 Identity = 30/42 (71.43%), Postives = 36/42 (85.71%), Query Frame = 2 Query: 179 MCRKVTCSKCGKPSWAGCGQHIESALSGVAEADRCPGWRSGK 304 MC KV C+ C K +W GCGQHI+SAL+GVA+ADRCPGWR+GK Sbjct: 1 MCFKVNCAVCQKATWQGCGQHIDSALAGVADADRCPGWRTGK 42
BLAST of mRNA_P-wetherbeei_contig1095.3.1 vs. uniprot
Match: A0A2D4BY36_PYTIN (Uncharacterized protein n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BY36_PYTIN) HSP 1 Score: 72.4 bits (176), Expect = 3.020e-14 Identity = 31/42 (73.81%), Postives = 34/42 (80.95%), Query Frame = 2 Query: 179 MCRKVTCSKCGKPSWAGCGQHIESALSGVAEADRCPGWRSGK 304 MC KV C C KP+W GCG H+ESALSGVAEADRCP W+SGK Sbjct: 1 MCMKVECPTCHKPTWRGCGFHVESALSGVAEADRCPEWKSGK 42
BLAST of mRNA_P-wetherbeei_contig1095.3.1 vs. uniprot
Match: A0A067CK00_SAPPC (Uncharacterized protein n=1 Tax=Saprolegnia parasitica (strain CBS 223.65) TaxID=695850 RepID=A0A067CK00_SAPPC) HSP 1 Score: 70.5 bits (171), Expect = 1.440e-13 Identity = 28/42 (66.67%), Postives = 35/42 (83.33%), Query Frame = 2 Query: 179 MCRKVTCSKCGKPSWAGCGQHIESALSGVAEADRCPGWRSGK 304 MC K++CS C K +W GCGQHI+SAL GV EA+RCPGWR+G+ Sbjct: 1 MCHKISCSVCQKATWQGCGQHIQSALQGVPEAERCPGWRTGQ 42
BLAST of mRNA_P-wetherbeei_contig1095.3.1 vs. uniprot
Match: A0A225VXX0_9STRA (Uncharacterized protein n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225VXX0_9STRA) HSP 1 Score: 69.3 bits (168), Expect = 3.980e-13 Identity = 29/42 (69.05%), Postives = 32/42 (76.19%), Query Frame = 2 Query: 179 MCRKVTCSKCGKPSWAGCGQHIESALSGVAEADRCPGWRSGK 304 MC KV C C KP+W GCG HIE+ALSGV E DRCP W+SGK Sbjct: 1 MCLKVECPTCNKPTWMGCGMHIEAALSGVKEEDRCPKWKSGK 42
BLAST of mRNA_P-wetherbeei_contig1095.3.1 vs. uniprot
Match: A0A1G9YCV5_9ACTO (Uncharacterized protein n=3 Tax=Actinomyces TaxID=1654 RepID=A0A1G9YCV5_9ACTO) HSP 1 Score: 68.6 bits (166), Expect = 9.370e-13 Identity = 28/37 (75.68%), Postives = 32/37 (86.49%), Query Frame = 2 Query: 179 MCRKVTCSKCGKPSWAGCGQHIESALSGVAEADRCPG 289 MCRKVTC KCGKP+WAGCGQHIE AL+GV ++ RC G Sbjct: 1 MCRKVTCKKCGKPTWAGCGQHIEQALAGVPKSQRCQG 37
BLAST of mRNA_P-wetherbeei_contig1095.3.1 vs. uniprot
Match: A0A7X0FRM2_9MICO (Uncharacterized protein n=1 Tax=Microbacterium thalassium TaxID=362649 RepID=A0A7X0FRM2_9MICO) HSP 1 Score: 67.8 bits (164), Expect = 1.180e-12 Identity = 27/37 (72.97%), Postives = 33/37 (89.19%), Query Frame = 2 Query: 179 MCRKVTCSKCGKPSWAGCGQHIESALSGVAEADRCPG 289 MC+++TCS CGKP+WAGCGQH+E AL+GVAE DRC G Sbjct: 1 MCQRITCSICGKPTWAGCGQHVELALAGVAEKDRCQG 37
BLAST of mRNA_P-wetherbeei_contig1095.3.1 vs. uniprot
Match: M4B7E5_HYAAE (Uncharacterized protein n=1 Tax=Hyaloperonospora arabidopsidis (strain Emoy2) TaxID=559515 RepID=M4B7E5_HYAAE) HSP 1 Score: 67.8 bits (164), Expect = 1.620e-12 Identity = 27/52 (51.92%), Postives = 38/52 (73.08%), Query Frame = 2 Query: 149 LSPRRKSTAIMCRKVTCSKCGKPSWAGCGQHIESALSGVAEADRCPGWRSGK 304 ++ +++ +MC KV CS C K SW GCG HI++AL+GV E DRCP W++GK Sbjct: 1 MNAKKRRKDLMCMKVECSTCHKASWKGCGLHIDTALNGVKEQDRCPNWKTGK 52
BLAST of mRNA_P-wetherbeei_contig1095.3.1 vs. uniprot
Match: A0A7X7JY28_9ACTN (Uncharacterized protein n=1 Tax=Propionibacterium sp. TaxID=1977903 RepID=A0A7X7JY28_9ACTN) HSP 1 Score: 67.4 bits (163), Expect = 2.240e-12 Identity = 28/37 (75.68%), Postives = 31/37 (83.78%), Query Frame = 2 Query: 179 MCRKVTCSKCGKPSWAGCGQHIESALSGVAEADRCPG 289 MC KVTC KCGKP+WAGCG HIESAL GVA++ RC G Sbjct: 1 MCHKVTCRKCGKPTWAGCGNHIESALKGVAKSQRCQG 37
BLAST of mRNA_P-wetherbeei_contig1095.3.1 vs. uniprot
Match: A0A6J6N9H1_9ZZZZ (Unannotated protein n=1 Tax=freshwater metagenome TaxID=449393 RepID=A0A6J6N9H1_9ZZZZ) HSP 1 Score: 67.0 bits (162), Expect = 2.320e-12 Identity = 28/35 (80.00%), Postives = 30/35 (85.71%), Query Frame = 2 Query: 179 MCRKVTCSKCGKPSWAGCGQHIESALSGVAEADRC 283 MC KVTC KCGKP+W GCG+HIE ALSGVAE DRC Sbjct: 1 MCSKVTCFKCGKPTWDGCGEHIEEALSGVAEQDRC 35 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1095.3.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1095.3.1 >prot_P-wetherbeei_contig1095.3.1 ID=prot_P-wetherbeei_contig1095.3.1|Name=mRNA_P-wetherbeei_contig1095.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=63bp MCRKVTCSKCGKPSWAGCGQHIESALSGVAEADRCPGWRSGKCTAAGGGDback to top mRNA from alignment at P-wetherbeei_contig1095:4349..4988+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1095.3.1 ID=mRNA_P-wetherbeei_contig1095.3.1|Name=mRNA_P-wetherbeei_contig1095.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=640bp|location=Sequence derived from alignment at P-wetherbeei_contig1095:4349..4988+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1095:4349..4988+ >mRNA_P-wetherbeei_contig1095.3.1 ID=mRNA_P-wetherbeei_contig1095.3.1|Name=mRNA_P-wetherbeei_contig1095.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=189bp|location=Sequence derived from alignment at P-wetherbeei_contig1095:4349..4988+ (Phaeothamnion wetherbeei SAG_119_79)back to top |