mRNA_P-wetherbeei_contig1072.4.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1072.4.1 vs. uniprot
Match: W7TQX4_9STRA (Cln3like protein n=4 Tax=Monodopsidaceae TaxID=425072 RepID=W7TQX4_9STRA) HSP 1 Score: 72.0 bits (175), Expect = 1.510e-10 Identity = 39/74 (52.70%), Postives = 52/74 (70.27%), Query Frame = 1 Query: 481 RDAAAFFSIGLINNAGYVIMMAAAKDIEGGGVGYVFLADVLPSFIVKLTGPYCKLSCRHVLRSL---FLDALSL 693 ++ AAF+++GL+NN YVIM+A AK+I GGVG VFLADV P+F+VKL+ PY + LR+ FL A SL Sbjct: 22 QNLAAFWALGLLNNVVYVIMLAGAKEINAGGVGLVFLADVAPTFLVKLSAPYWFHHVSYSLRASLCGFLMAASL 95
BLAST of mRNA_P-wetherbeei_contig1072.4.1 vs. uniprot
Match: D7FPF3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FPF3_ECTSI) HSP 1 Score: 67.0 bits (162), Expect = 1.870e-10 Identity = 31/53 (58.49%), Postives = 40/53 (75.47%), Query Frame = 1 Query: 478 LRDAAAFFSIGLINNAGYVIMMAAAKDIEGGGVGYVFLADVLPSFIVKLTGPY 636 LR+ AAF+ +GLINN+ YVIMMA AK+I VG VF ADV P+ ++K+T PY Sbjct: 60 LRNDAAFWLLGLINNSSYVIMMAVAKEIAPDAVGVVFFADVAPTMVIKVTAPY 112
BLAST of mRNA_P-wetherbeei_contig1072.4.1 vs. uniprot
Match: A0A7R9VN91_9STRA (Hypothetical protein (Fragment) n=1 Tax=Pseudictyota dubia TaxID=2749911 RepID=A0A7R9VN91_9STRA) HSP 1 Score: 67.0 bits (162), Expect = 3.080e-10 Identity = 33/58 (56.90%), Postives = 42/58 (72.41%), Query Frame = 1 Query: 463 QRRRALRDAAAFFSIGLINNAGYVIMMAAAKDIEGGGVGYVFLADVLPSFIVKLTGPY 636 +R R AAF+ +GL+NNA YVIM+A+AK I GG VFLA+V+PS +VKLT PY Sbjct: 25 RRSRDRPPLAAFWILGLLNNAAYVIMLASAKSISEGGTAMVFLANVMPSLMVKLTAPY 82
BLAST of mRNA_P-wetherbeei_contig1072.4.1 vs. uniprot
Match: A0A485K781_9STRA (Aste57867_2294 protein n=1 Tax=Aphanomyces stellatus TaxID=120398 RepID=A0A485K781_9STRA) HSP 1 Score: 69.3 bits (168), Expect = 9.590e-10 Identity = 31/50 (62.00%), Postives = 41/50 (82.00%), Query Frame = 1 Query: 487 AAAFFSIGLINNAGYVIMMAAAKDIEGGGVGYVFLADVLPSFIVKLTGPY 636 AAAF+ +GL+NN YVIM+A AKDI GGVG V++++VLPS +V+ TGPY Sbjct: 10 AAAFWVLGLVNNIPYVIMIAGAKDINSGGVGLVYVSEVLPSLLVQFTGPY 59
BLAST of mRNA_P-wetherbeei_contig1072.4.1 vs. uniprot
Match: A0A6A4ZGK5_9STRA (Uncharacterized protein n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A6A4ZGK5_9STRA) HSP 1 Score: 67.4 bits (163), Expect = 1.700e-9 Identity = 30/49 (61.22%), Postives = 41/49 (83.67%), Query Frame = 1 Query: 490 AAFFSIGLINNAGYVIMMAAAKDIEGGGVGYVFLADVLPSFIVKLTGPY 636 AAF+ +GL+NN YVIM+A AKDI GGVG V++A+VLP+ +V+L+GPY Sbjct: 6 AAFWLLGLVNNIPYVIMIAGAKDIAAGGVGLVYVAEVLPTLLVQLSGPY 54
BLAST of mRNA_P-wetherbeei_contig1072.4.1 vs. uniprot
Match: A0A6A3RF54_9STRA (Uncharacterized protein n=3 Tax=Phytophthora TaxID=4783 RepID=A0A6A3RF54_9STRA) HSP 1 Score: 68.2 bits (165), Expect = 2.640e-9 Identity = 29/53 (54.72%), Postives = 41/53 (77.36%), Query Frame = 1 Query: 478 LRDAAAFFSIGLINNAGYVIMMAAAKDIEGGGVGYVFLADVLPSFIVKLTGPY 636 LR+ AF+ +G +NN GYVIM+A A++I GGVG V+L D+ P+ +VKL+GPY Sbjct: 14 LRNLVAFWVLGFVNNIGYVIMIAGAQEIAAGGVGLVYLFDIFPALLVKLSGPY 66
BLAST of mRNA_P-wetherbeei_contig1072.4.1 vs. uniprot
Match: A0A448Z0W3_9STRA (Uncharacterized protein n=1 Tax=Pseudo-nitzschia multistriata TaxID=183589 RepID=A0A448Z0W3_9STRA) HSP 1 Score: 68.2 bits (165), Expect = 3.230e-9 Identity = 42/84 (50.00%), Postives = 55/84 (65.48%), Query Frame = 1 Query: 463 QRRR--ALRDAAAFFSIGLINNAGYVIMMAAAKDIEGGGVGYVFLADVLPSFIVKLTGPYC--KLSCRHVLRSLFLDALSLFPS 702 QRRR A+R A+F+ +GL+NNAGY IM+AAAK+I GGV VFLA++LP+ +K T PY K+S R LF S+ S Sbjct: 56 QRRRGIAVRLRASFWLMGLLNNAGYTIMIAAAKNISEGGVALVFLANILPALGIKATAPYWFEKVSYE---RRLFASTASMVAS 136
BLAST of mRNA_P-wetherbeei_contig1072.4.1 vs. uniprot
Match: H3GX09_PHYRM (Uncharacterized protein n=1 Tax=Phytophthora ramorum TaxID=164328 RepID=H3GX09_PHYRM) HSP 1 Score: 67.8 bits (164), Expect = 3.470e-9 Identity = 29/53 (54.72%), Postives = 41/53 (77.36%), Query Frame = 1 Query: 478 LRDAAAFFSIGLINNAGYVIMMAAAKDIEGGGVGYVFLADVLPSFIVKLTGPY 636 LR+ AF+ +G +NN GYVIM+A A++I GGVG V+L D+ P+ +VKL+GPY Sbjct: 10 LRNLLAFWVLGFVNNIGYVIMIAGAQEIAAGGVGLVYLFDIFPALLVKLSGPY 62
BLAST of mRNA_P-wetherbeei_contig1072.4.1 vs. uniprot
Match: A0A6H5JLK7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JLK7_9PHAE) HSP 1 Score: 67.0 bits (162), Expect = 7.210e-9 Identity = 31/53 (58.49%), Postives = 40/53 (75.47%), Query Frame = 1 Query: 478 LRDAAAFFSIGLINNAGYVIMMAAAKDIEGGGVGYVFLADVLPSFIVKLTGPY 636 LR+ AAF+ +GLINN+ YVIMMA AK+I VG VF ADV P+ ++K+T PY Sbjct: 60 LRNDAAFWLLGLINNSSYVIMMAVAKEIAPDAVGVVFFADVAPTMVIKVTAPY 112
BLAST of mRNA_P-wetherbeei_contig1072.4.1 vs. uniprot
Match: A0A1E7FPB7_9STRA (Uncharacterized protein n=1 Tax=Fragilariopsis cylindrus CCMP1102 TaxID=635003 RepID=A0A1E7FPB7_9STRA) HSP 1 Score: 65.9 bits (159), Expect = 2.000e-8 Identity = 30/53 (56.60%), Postives = 41/53 (77.36%), Query Frame = 1 Query: 478 LRDAAAFFSIGLINNAGYVIMMAAAKDIEGGGVGYVFLADVLPSFIVKLTGPY 636 +R + +F+ +GL+NN GYVIM+AAAK I GGV VFLA++LP+ +VK T PY Sbjct: 94 IRFSISFWILGLLNNTGYVIMIAAAKSISEGGVALVFLANILPALVVKGTAPY 146 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1072.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1072.4.1 >prot_P-wetherbeei_contig1072.4.1 ID=prot_P-wetherbeei_contig1072.4.1|Name=mRNA_P-wetherbeei_contig1072.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=157bp MTKGPQYASFEVTEESRTAATQIQSPPGPVAALSRVMDIGFKAEEYELLDback to top mRNA from alignment at P-wetherbeei_contig1072:6586..7870+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1072.4.1 ID=mRNA_P-wetherbeei_contig1072.4.1|Name=mRNA_P-wetherbeei_contig1072.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=1285bp|location=Sequence derived from alignment at P-wetherbeei_contig1072:6586..7870+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1072:6586..7870+ >mRNA_P-wetherbeei_contig1072.4.1 ID=mRNA_P-wetherbeei_contig1072.4.1|Name=mRNA_P-wetherbeei_contig1072.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=471bp|location=Sequence derived from alignment at P-wetherbeei_contig1072:6586..7870+ (Phaeothamnion wetherbeei SAG_119_79)back to top |