mRNA_P-wetherbeei_contig107.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig107.2.1 vs. uniprot
Match: UPI0016034196 (beta-alanine-activating enzyme-like n=1 Tax=Branchiostoma floridae TaxID=7739 RepID=UPI0016034196) HSP 1 Score: 60.8 bits (146), Expect = 5.660e-9 Identity = 30/58 (51.72%), Postives = 43/58 (74.14%), Query Frame = 1 Query: 43 CVVAAATGGLVAVLSLASGTVLVATQLGGEVFSSPVAVDNAVVIGCRNDFVYVLRVRG 216 CV A+T G + +L+L SG+ L + +L GEVFSSPV +N +V+GCR+DFVY ++V G Sbjct: 941 CVAVASTKGTLYILTLDSGSCLASLRLPGEVFSSPVVWNNLLVVGCRDDFVYGIKVMG 998
BLAST of mRNA_P-wetherbeei_contig107.2.1 vs. uniprot
Match: A0A8K0A0M6_BRALA (AASDH protein n=3 Tax=Branchiostoma lanceolatum TaxID=7740 RepID=A0A8K0A0M6_BRALA) HSP 1 Score: 58.5 bits (140), Expect = 3.710e-8 Identity = 29/56 (51.79%), Postives = 41/56 (73.21%), Query Frame = 1 Query: 43 CVVAAATGGLVAVLSLASGTVLVATQLGGEVFSSPVAVDNAVVIGCRNDFVYVLRV 210 CV A+T G++ +L+L SG+ L + +L GEVFSSPV N +V+GCRND VY ++V Sbjct: 1122 CVAVASTKGMLYILTLDSGSCLTSLRLPGEVFSSPVVWGNLLVVGCRNDLVYGVKV 1177
BLAST of mRNA_P-wetherbeei_contig107.2.1 vs. uniprot
Match: A0A2B4RXM3_STYPI (Acyl-CoA synthetase family member 4 n=1 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4RXM3_STYPI) HSP 1 Score: 56.6 bits (135), Expect = 1.580e-7 Identity = 29/65 (44.62%), Postives = 41/65 (63.08%), Query Frame = 1 Query: 16 CDDCGRSIACVVAAATGGLVAVLSLASGTVLVATQLGGEVFSSPVAVDNAVVIGCRNDFVYVLRV 210 CD C +A V A + G + +L SG +L L GE+FSSPV VDN ++IGCR+D++Y L + Sbjct: 263 CDKCDTQLA-VFALSIVGTLYILDFYSGVLLALHSLPGEIFSSPVVVDNQILIGCRDDYLYSLEI 326
BLAST of mRNA_P-wetherbeei_contig107.2.1 vs. uniprot
Match: A0A0B6YV06_9EUPU (PQQ_3 domain-containing protein (Fragment) n=1 Tax=Arion vulgaris TaxID=1028688 RepID=A0A0B6YV06_9EUPU) HSP 1 Score: 56.6 bits (135), Expect = 1.740e-7 Identity = 29/55 (52.73%), Postives = 38/55 (69.09%), Query Frame = 1 Query: 46 VVAAATGGLVAVLSLASGTVLVATQLGGEVFSSPVAVDNAVVIGCRNDFVYVLRV 210 VV A+T G + +L+ G +L +L GEVFSSPV VDN V +GCR++FVY L V Sbjct: 654 VVTASTAGTIYMLNFQDGKLLSELKLPGEVFSSPVVVDNFVAVGCRDNFVYCLEV 708
BLAST of mRNA_P-wetherbeei_contig107.2.1 vs. uniprot
Match: D8LQF8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LQF8_ECTSI) HSP 1 Score: 56.2 bits (134), Expect = 2.420e-7 Identity = 31/69 (44.93%), Postives = 42/69 (60.87%), Query Frame = 1 Query: 16 CDDCGRSIACVVAAATGGLVAVLSLASGTVLVATQLGGEVFSSPVAVDNAVVIGCRNDFVYVLRVRGLC 222 C+ C V+A + GL++ LSLA G VL QL GE+FSS V +VV+GCR++ VYVL + C Sbjct: 1116 CEGCALLCPLVLACSVPGLISALSLADGEVLGEIQLPGEIFSSAVVAGPSVVVGCRDNRVYVLDILMTC 1184
BLAST of mRNA_P-wetherbeei_contig107.2.1 vs. uniprot
Match: G1T2T7_RABIT (Aminoadipate-semialdehyde dehydrogenase n=3 Tax=Oryctolagus cuniculus TaxID=9986 RepID=G1T2T7_RABIT) HSP 1 Score: 55.8 bits (133), Expect = 3.300e-7 Identity = 31/61 (50.82%), Postives = 42/61 (68.85%), Query Frame = 1 Query: 34 SIACVVAAATGGLVAVLSLASGTVLVATQLGGEVFSSPVAVDNAVVIGCRNDFVYVLRVRG 216 S A + AA+T G + +L ASG + +L GEVFSSPV ++ +VIGCRND+VY L +RG Sbjct: 1028 SAALLAAASTDGKLWILDSASGQLQDVYELPGEVFSSPVVWESMLVIGCRNDYVYCLDLRG 1088
BLAST of mRNA_P-wetherbeei_contig107.2.1 vs. uniprot
Match: UPI0009E2835D (acyl-CoA synthetase family member 4-like n=1 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E2835D) HSP 1 Score: 55.1 bits (131), Expect = 6.180e-7 Identity = 28/50 (56.00%), Postives = 35/50 (70.00%), Query Frame = 1 Query: 61 TGGLVAVLSLASGTVLVATQLGGEVFSSPVAVDNAVVIGCRNDFVYVLRV 210 T G + VL L SG L + L GEVFSSPV VDN ++IGCRND++Y L + Sbjct: 1198 TLGTLYVLDLYSGVYLASYSLPGEVFSSPVVVDNRLLIGCRNDYMYSLEI 1247
BLAST of mRNA_P-wetherbeei_contig107.2.1 vs. uniprot
Match: A0A3B5AM09_9TELE (Aminoadipate-semialdehyde dehydrogenase n=2 Tax=Stegastes partitus TaxID=144197 RepID=A0A3B5AM09_9TELE) HSP 1 Score: 54.7 bits (130), Expect = 8.430e-7 Identity = 30/61 (49.18%), Postives = 43/61 (70.49%), Query Frame = 1 Query: 28 GRSIACVVAAATGGLVAVLSLASGTVLVATQLGGEVFSSPVAVDNAVVIGCRNDFVYVLRV 210 GR+ A V A+T G V +L +G +L + L GE+FSSPVA + ++VIGCRND+VY L++ Sbjct: 1059 GRTGALVGLASTDGTVWILDGQNGQMLASLALPGELFSSPVAWEQSLVIGCRNDYVYCLKL 1119
BLAST of mRNA_P-wetherbeei_contig107.2.1 vs. uniprot
Match: A0A6S7H7P2_PARCT (Acyl- synthetase family member 4 isoform X1 n=1 Tax=Paramuricea clavata TaxID=317549 RepID=A0A6S7H7P2_PARCT) HSP 1 Score: 54.3 bits (129), Expect = 1.140e-6 Identity = 25/67 (37.31%), Postives = 42/67 (62.69%), Query Frame = 1 Query: 10 FRCDDCGRSIACVVAAATGGLVAVLSLASGTVLVATQLGGEVFSSPVAVDNAVVIGCRNDFVYVLRV 210 F G + C+V T G + +L+ ++G +L L GEVFSSP+ V + +V+GCRND++Y +++ Sbjct: 841 FTSQTFGSNSVCIVVVTTKGTMYLLAASNGKILKTFSLPGEVFSSPIIVGSDIVLGCRNDYLYCVKL 907
BLAST of mRNA_P-wetherbeei_contig107.2.1 vs. uniprot
Match: A0A6P5AVT1_BRABE (acyl-CoA synthetase family member 4-like n=1 Tax=Branchiostoma belcheri TaxID=7741 RepID=A0A6P5AVT1_BRABE) HSP 1 Score: 53.5 bits (127), Expect = 2.150e-6 Identity = 28/57 (49.12%), Postives = 39/57 (68.42%), Query Frame = 1 Query: 43 CVVAAATGGLVAVLSLASGTVLVATQLGGEVFSSPVAVDNAVVIGCRNDFVYVLRVR 213 CV A+T G + +L+L SG+ L L GEVFSSPV + +V+GCR+D VY ++VR Sbjct: 1074 CVAVASTKGTLYILTLDSGSCLSTLTLPGEVFSSPVVWGDLLVVGCRDDLVYGVKVR 1130 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig107.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig107.2.1 >prot_P-wetherbeei_contig107.2.1 ID=prot_P-wetherbeei_contig107.2.1|Name=mRNA_P-wetherbeei_contig107.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=80bp PCRFRCDDCGRSIACVVAAATGGLVAVLSLASGTVLVATQLGGEVFSSPVback to top mRNA from alignment at P-wetherbeei_contig107:12322..12561+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig107.2.1 ID=mRNA_P-wetherbeei_contig107.2.1|Name=mRNA_P-wetherbeei_contig107.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=240bp|location=Sequence derived from alignment at P-wetherbeei_contig107:12322..12561+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig107:12322..12561+ >mRNA_P-wetherbeei_contig107.2.1 ID=mRNA_P-wetherbeei_contig107.2.1|Name=mRNA_P-wetherbeei_contig107.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=240bp|location=Sequence derived from alignment at P-wetherbeei_contig107:12322..12561+ (Phaeothamnion wetherbeei SAG_119_79)back to top |