mRNA_P-wetherbeei_contig10673.4.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10673.4.1 vs. uniprot
Match: A0A0D2MIV8_9CHLO (Uncharacterized protein n=1 Tax=Monoraphidium neglectum TaxID=145388 RepID=A0A0D2MIV8_9CHLO) HSP 1 Score: 50.1 bits (118), Expect = 6.260e-5 Identity = 22/37 (59.46%), Postives = 24/37 (64.86%), Query Frame = 2 Query: 140 SRVCDAPDCGKRPSFGFPGDRARV-CSAHRAEGMQDV 247 S+ C AP+CGK PSF FPG R R C H A GM DV Sbjct: 83 SQACKAPNCGKAPSFNFPGTRERAFCKTHAAPGMVDV 119 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10673.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10673.4.1 >prot_P-wetherbeei_contig10673.4.1 ID=prot_P-wetherbeei_contig10673.4.1|Name=mRNA_P-wetherbeei_contig10673.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=98bp AAGRRRRGHAGATGRAARHATAACAGGPDRGAQDGRHSMAIWPRLRQPRVback to top mRNA from alignment at P-wetherbeei_contig10673:1229..2041+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10673.4.1 ID=mRNA_P-wetherbeei_contig10673.4.1|Name=mRNA_P-wetherbeei_contig10673.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=813bp|location=Sequence derived from alignment at P-wetherbeei_contig10673:1229..2041+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10673:1229..2041+ >mRNA_P-wetherbeei_contig10673.4.1 ID=mRNA_P-wetherbeei_contig10673.4.1|Name=mRNA_P-wetherbeei_contig10673.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=294bp|location=Sequence derived from alignment at P-wetherbeei_contig10673:1229..2041+ (Phaeothamnion wetherbeei SAG_119_79)back to top |