mRNA_P-wetherbeei_contig10628.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10628.1.1 vs. uniprot
Match: D7FVY5_ECTSI (Flagellar associated protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FVY5_ECTSI) HSP 1 Score: 109 bits (272), Expect = 3.330e-26 Identity = 50/71 (70.42%), Postives = 63/71 (88.73%), Query Frame = 1 Query: 1 VGKWNHLDNFYKRFNKVLLDKVAVEREQARLERENADLRAIIKQCVDGVSVNDDVLSQPNPLLVVNGRINV 213 V +WNHLDNF+KR+NK LLDK+AVEREQ RLE EN DL++I+KQ +DG+SV +DV+S PNPLLVVNGR+N+ Sbjct: 565 VPRWNHLDNFHKRYNKALLDKLAVEREQNRLEAENRDLQSIVKQYLDGISVPEDVVSAPNPLLVVNGRVNM 635
BLAST of mRNA_P-wetherbeei_contig10628.1.1 vs. uniprot
Match: A0A7S0WSJ2_9CHLO (Hypothetical protein (Fragment) n=1 Tax=Chlamydomonas leiostraca TaxID=1034604 RepID=A0A7S0WSJ2_9CHLO) HSP 1 Score: 97.4 bits (241), Expect = 8.850e-24 Identity = 44/72 (61.11%), Postives = 63/72 (87.50%), Query Frame = 1 Query: 1 VGKWNHLDNFYKRFNKVLLDKVAVEREQARLERENADLRAIIKQCVDGVSVNDDVLSQP-NPLLVVNGRINV 213 V +W++L+ F++RFNK +LDK A+++E+ARLE+ENADLR+I+KQ +DG+SVNDDV++ P NPLLVVN R+ V Sbjct: 103 VEEWDYLNRFFRRFNKAVLDKAAIDKEKARLEKENADLRSILKQYLDGISVNDDVMNNPINPLLVVNNRLQV 174
BLAST of mRNA_P-wetherbeei_contig10628.1.1 vs. uniprot
Match: A0A0M0J8N3_9EUKA (Flagellar associated protein n=1 Tax=Chrysochromulina tobinii TaxID=1460289 RepID=A0A0M0J8N3_9EUKA) HSP 1 Score: 101 bits (252), Expect = 1.410e-23 Identity = 46/71 (64.79%), Postives = 61/71 (85.92%), Query Frame = 1 Query: 1 VGKWNHLDNFYKRFNKVLLDKVAVEREQARLERENADLRAIIKQCVDGVSVNDDVLSQPNPLLVVNGRINV 213 V +WN LDNF+KR+NKVLLD +A+ERE+ARL EN DLR+I+KQ +DG+SVN+DV++ PNPLLVVN + N+ Sbjct: 411 VEEWNCLDNFFKRYNKVLLDVLAIERERARLRSENGDLRSILKQYLDGISVNEDVINNPNPLLVVNHKTNI 481
BLAST of mRNA_P-wetherbeei_contig10628.1.1 vs. uniprot
Match: A0A8J4ETC5_9CHLO (Uncharacterized protein n=3 Tax=Volvox TaxID=3066 RepID=A0A8J4ETC5_9CHLO) HSP 1 Score: 100 bits (249), Expect = 4.280e-23 Identity = 46/72 (63.89%), Postives = 63/72 (87.50%), Query Frame = 1 Query: 1 VGKWNHLDNFYKRFNKVLLDKVAVEREQARLERENADLRAIIKQCVDGVSVNDDVLSQP-NPLLVVNGRINV 213 V +W++L+ F+KR+NK LLDK A+++E+ARLERENADLR+I+KQ +DG+SVNDDVL+ P NPLLVVN R+ + Sbjct: 486 VDEWDYLNRFFKRYNKALLDKTAIDKEKARLERENADLRSILKQYLDGISVNDDVLNNPVNPLLVVNNRLQI 557
BLAST of mRNA_P-wetherbeei_contig10628.1.1 vs. uniprot
Match: A0A7S0YHR8_9CHLO (Hypothetical protein (Fragment) n=1 Tax=Polytomella parva TaxID=51329 RepID=A0A7S0YHR8_9CHLO) HSP 1 Score: 96.3 bits (238), Expect = 4.910e-23 Identity = 44/72 (61.11%), Postives = 61/72 (84.72%), Query Frame = 1 Query: 1 VGKWNHLDNFYKRFNKVLLDKVAVEREQARLERENADLRAIIKQCVDGVSVNDDVLSQP-NPLLVVNGRINV 213 + +W++L+N +KR+NK LLD VA+ +E+ RLERENADLR+I+KQ +DG+SVNDDVL+ P NPLLVVN R+ + Sbjct: 64 IEEWDYLNNTFKRYNKALLDNVAISKERTRLERENADLRSILKQYLDGISVNDDVLNNPINPLLVVNNRLQI 135
BLAST of mRNA_P-wetherbeei_contig10628.1.1 vs. uniprot
Match: A0A150GPR3_GONPE (Uncharacterized protein n=1 Tax=Gonium pectorale TaxID=33097 RepID=A0A150GPR3_GONPE) HSP 1 Score: 100 bits (248), Expect = 5.810e-23 Identity = 46/72 (63.89%), Postives = 63/72 (87.50%), Query Frame = 1 Query: 1 VGKWNHLDNFYKRFNKVLLDKVAVEREQARLERENADLRAIIKQCVDGVSVNDDVLSQP-NPLLVVNGRINV 213 V +W++L+ F+KR+NK LLDK A+++E+ARLERENADLR+I+KQ +DG+SVNDDVL+ P NPLLVVN R+ + Sbjct: 497 VQEWDYLNRFFKRYNKALLDKAAIDKEKARLERENADLRSILKQYLDGISVNDDVLNNPVNPLLVVNNRLQI 568
BLAST of mRNA_P-wetherbeei_contig10628.1.1 vs. uniprot
Match: D8U524_VOLCA (Uncharacterized protein (Fragment) n=1 Tax=Volvox carteri f. nagariensis TaxID=3068 RepID=D8U524_VOLCA) HSP 1 Score: 100 bits (248), Expect = 6.010e-23 Identity = 46/72 (63.89%), Postives = 63/72 (87.50%), Query Frame = 1 Query: 1 VGKWNHLDNFYKRFNKVLLDKVAVEREQARLERENADLRAIIKQCVDGVSVNDDVLSQP-NPLLVVNGRINV 213 V +W++L+ F+KR+NK LLDK A+++E+ARLERENADLR+I+KQ +DG+SVNDDVL+ P NPLLVVN R+ + Sbjct: 516 VEEWDYLNRFFKRYNKALLDKAAIDKEKARLERENADLRSILKQYLDGISVNDDVLNNPVNPLLVVNNRLQI 587
BLAST of mRNA_P-wetherbeei_contig10628.1.1 vs. uniprot
Match: A0A7S4PVM2_9DINO (Hypothetical protein n=1 Tax=Alexandrium monilatum TaxID=311494 RepID=A0A7S4PVM2_9DINO) HSP 1 Score: 99.4 bits (246), Expect = 9.720e-23 Identity = 45/71 (63.38%), Postives = 59/71 (83.10%), Query Frame = 1 Query: 1 VGKWNHLDNFYKRFNKVLLDKVAVEREQARLERENADLRAIIKQCVDGVSVNDDVLSQPNPLLVVNGRINV 213 + +W LDNF+KRFNKV LD VA+ERE RL +EN LR+I+KQ +DGVSVN++VL+ PNPLLVVNG++N+ Sbjct: 436 IDEWTFLDNFFKRFNKVKLDSVAIERELERLGKENGQLRSILKQFLDGVSVNEEVLANPNPLLVVNGKVNL 506
BLAST of mRNA_P-wetherbeei_contig10628.1.1 vs. uniprot
Match: A0A835XVY2_9CHLO (Uncharacterized protein n=1 Tax=Edaphochlamys debaryana TaxID=47281 RepID=A0A835XVY2_9CHLO) HSP 1 Score: 99.0 bits (245), Expect = 1.460e-22 Identity = 46/72 (63.89%), Postives = 63/72 (87.50%), Query Frame = 1 Query: 1 VGKWNHLDNFYKRFNKVLLDKVAVEREQARLERENADLRAIIKQCVDGVSVNDDVLSQP-NPLLVVNGRINV 213 V +W++L+ F+KRFNK LLDK A+++E++RLERENADLR+I+KQ +DG+SVNDDVL+ P NPLLVVN R+ + Sbjct: 480 VDEWDYLNRFFKRFNKSLLDKAAIDKERSRLERENADLRSILKQYLDGISVNDDVLNNPVNPLLVVNQRLQI 551
BLAST of mRNA_P-wetherbeei_contig10628.1.1 vs. uniprot
Match: A0A7S4MHI3_9EUKA (Hypothetical protein n=1 Tax=Prymnesium polylepis TaxID=72548 RepID=A0A7S4MHI3_9EUKA) HSP 1 Score: 97.4 bits (241), Expect = 2.250e-22 Identity = 42/71 (59.15%), Postives = 62/71 (87.32%), Query Frame = 1 Query: 1 VGKWNHLDNFYKRFNKVLLDKVAVEREQARLERENADLRAIIKQCVDGVSVNDDVLSQPNPLLVVNGRINV 213 V +W++L+NF+KR+NKVLLD +A++RE+ RL EN+DLR+I+KQ +DG+SVN+DV++ PNPLLVVN + N+ Sbjct: 286 VEEWDYLNNFFKRYNKVLLDVMAIDREKERLSHENSDLRSILKQYLDGISVNEDVINNPNPLLVVNHKTNI 356 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10628.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10628.1.1 >prot_P-wetherbeei_contig10628.1.1 ID=prot_P-wetherbeei_contig10628.1.1|Name=mRNA_P-wetherbeei_contig10628.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=71bp VGKWNHLDNFYKRFNKVLLDKVAVEREQARLERENADLRAIIKQCVDGVSback to top mRNA from alignment at P-wetherbeei_contig10628:347..816+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10628.1.1 ID=mRNA_P-wetherbeei_contig10628.1.1|Name=mRNA_P-wetherbeei_contig10628.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=470bp|location=Sequence derived from alignment at P-wetherbeei_contig10628:347..816+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10628:347..816+ >mRNA_P-wetherbeei_contig10628.1.1 ID=mRNA_P-wetherbeei_contig10628.1.1|Name=mRNA_P-wetherbeei_contig10628.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=213bp|location=Sequence derived from alignment at P-wetherbeei_contig10628:347..816+ (Phaeothamnion wetherbeei SAG_119_79)back to top |