mRNA_P-wetherbeei_contig10580.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10580.1.1 vs. uniprot
Match: A0A835XZ70_9CHLO (Uncharacterized protein n=1 Tax=Edaphochlamys debaryana TaxID=47281 RepID=A0A835XZ70_9CHLO) HSP 1 Score: 59.7 bits (143), Expect = 4.830e-9 Identity = 30/49 (61.22%), Postives = 37/49 (75.51%), Query Frame = 1 Query: 1 MIQPLLDAGADLNAQNRNGQTPLHAAALVGNLETCKVLLDARARPDIAD 147 + Q +L AGAD+NA+N +G TPL AAL GNLE +VLLDARA DIA+ Sbjct: 412 VTQAVLQAGADVNARNEHGHTPLALAALRGNLEAVRVLLDARADADIAE 460
BLAST of mRNA_P-wetherbeei_contig10580.1.1 vs. uniprot
Match: A0A6H5KTN1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KTN1_9PHAE) HSP 1 Score: 54.7 bits (130), Expect = 2.830e-7 Identity = 26/45 (57.78%), Postives = 34/45 (75.56%), Query Frame = 1 Query: 1 MIQPLLDAGADLNAQNRNGQTPLHAAALVGNLETCKVLLDARARP 135 +I+ LL+AGAD+ A N NG+TPLH AA GN T ++LL+A ARP Sbjct: 227 IIRMLLEAGADVEAVNPNGRTPLHLAAAEGNCSTARLLLEAGARP 271
BLAST of mRNA_P-wetherbeei_contig10580.1.1 vs. uniprot
Match: A0A1M5XL89_9FLAO (Ankyrin repeat-containing protein n=1 Tax=Flavobacterium sp. CF108 TaxID=1882758 RepID=A0A1M5XL89_9FLAO) HSP 1 Score: 52.8 bits (125), Expect = 4.270e-7 Identity = 24/54 (44.44%), Postives = 39/54 (72.22%), Query Frame = 1 Query: 1 MIQPLLDAGADLNAQNRNGQTPLHAAALVGNLETCKVLLDARARPDIADCNGVT 162 +I+ LL+ GAD+N Q++NG T LH +A GN+++ +LL+ +A P+I D +G T Sbjct: 50 IIKWLLEQGADINLQDKNGYTALHFSAQEGNIDSTMLLLENKANPNIKDIHGNT 103
BLAST of mRNA_P-wetherbeei_contig10580.1.1 vs. uniprot
Match: A0A3N4L082_9PEZI (Ankyrin n=2 Tax=Morchella TaxID=5193 RepID=A0A3N4L082_9PEZI) HSP 1 Score: 53.5 bits (127), Expect = 7.240e-7 Identity = 23/54 (42.59%), Postives = 37/54 (68.52%), Query Frame = 1 Query: 1 MIQPLLDAGADLNAQNRNGQTPLHAAALVGNLETCKVLLDARARPDIADCNGVT 162 +++ LLD GA + +N+ QTPL+AAA +GN E+ ++LL+ A P + D +G T Sbjct: 448 LVRRLLDKGATVGPKNKRNQTPLYAAAAIGNAESVRILLERGASPRVRDSSGKT 501
BLAST of mRNA_P-wetherbeei_contig10580.1.1 vs. uniprot
Match: A0A158QGD0_HYMDI (PDZ domain-containing protein n=4 Tax=Hymenolepis diminuta TaxID=6216 RepID=A0A158QGD0_HYMDI) HSP 1 Score: 53.5 bits (127), Expect = 7.290e-7 Identity = 26/54 (48.15%), Postives = 33/54 (61.11%), Query Frame = 1 Query: 1 MIQPLLDAGADLNAQNRNGQTPLHAAALVGNLETCKVLLDARARPDIADCNGVT 162 MI+ L+ GA + + RNG TPLH AA +GN E K LLD P+ D NG+T Sbjct: 189 MIKTLIAGGAHKDYRTRNGITPLHRAAAIGNFEAVKALLDFGQSPNTLDSNGLT 242
BLAST of mRNA_P-wetherbeei_contig10580.1.1 vs. uniprot
Match: A0A158QHE4_RODNA (Uncharacterized protein n=1 Tax=Rodentolepis nana TaxID=102285 RepID=A0A158QHE4_RODNA) HSP 1 Score: 53.5 bits (127), Expect = 7.300e-7 Identity = 26/54 (48.15%), Postives = 33/54 (61.11%), Query Frame = 1 Query: 1 MIQPLLDAGADLNAQNRNGQTPLHAAALVGNLETCKVLLDARARPDIADCNGVT 162 MI+ L+ GA + + RNG TPLH AA +GN E K LLD P+ D NG+T Sbjct: 189 MIKVLIAGGAHKDYRTRNGVTPLHKAAAIGNFEAVKALLDFGQSPNTLDSNGLT 242
BLAST of mRNA_P-wetherbeei_contig10580.1.1 vs. uniprot
Match: UPI001D04367F (uncharacterized protein n=1 Tax=Morchella sextelata TaxID=1174677 RepID=UPI001D04367F) HSP 1 Score: 51.2 bits (121), Expect = 1.080e-6 Identity = 23/54 (42.59%), Postives = 36/54 (66.67%), Query Frame = 1 Query: 1 MIQPLLDAGADLNAQNRNGQTPLHAAALVGNLETCKVLLDARARPDIADCNGVT 162 +++ LLD GA + +N+ QTPL+AAA +GN E+ + LL+ A P + D +G T Sbjct: 55 LVRRLLDGGATVGPKNKLNQTPLYAAASIGNAESVRTLLERGASPRVRDSSGKT 108
BLAST of mRNA_P-wetherbeei_contig10580.1.1 vs. uniprot
Match: A0A218KM91_9RICK (Uncharacterized protein n=1 Tax=Wolbachia endosymbiont of Folsomia candida TaxID=169402 RepID=A0A218KM91_9RICK) HSP 1 Score: 52.4 bits (124), Expect = 1.850e-6 Identity = 28/54 (51.85%), Postives = 33/54 (61.11%), Query Frame = 1 Query: 1 MIQPLLDAGADLNAQNRNGQTPLHAAALVGNLETCKVLLDARARPDIADCNGVT 162 M + LLDAGAD NAQN G TPLH AA GNL ++LL A P + + N T Sbjct: 60 MTRCLLDAGADFNAQNEEGNTPLHNAAWSGNLFATQLLLQKEADPFLKNNNHQT 113
BLAST of mRNA_P-wetherbeei_contig10580.1.1 vs. uniprot
Match: A0A8H4XDJ7_9HYPO (HET domain-containing protein n=1 Tax=Fusarium sarcochroum TaxID=1208366 RepID=A0A8H4XDJ7_9HYPO) HSP 1 Score: 52.0 bits (123), Expect = 2.570e-6 Identity = 24/49 (48.98%), Postives = 32/49 (65.31%), Query Frame = 1 Query: 13 LLDAGADLNAQNRNGQTPLHAAALVGNLETCKVLLDARARPDIADCNGV 159 LL GAD+NAQ R+G TPLH A GN+ KVL++ A D+ D +G+ Sbjct: 1063 LLQEGADINAQGRDGVTPLHCAVKKGNINIAKVLVETGAAIDVPDSSGM 1111
BLAST of mRNA_P-wetherbeei_contig10580.1.1 vs. uniprot
Match: A0A087ULF5_STEMI (Protein phosphatase 1 regulatory subunit 12A (Fragment) n=1 Tax=Stegodyphus mimosarum TaxID=407821 RepID=A0A087ULF5_STEMI) HSP 1 Score: 51.6 bits (122), Expect = 3.480e-6 Identity = 27/50 (54.00%), Postives = 31/50 (62.00%), Query Frame = 1 Query: 13 LLDAGADLNAQNRNGQTPLHAAALVGNLETCKVLLDARARPDIADCNGVT 162 L+ GADLNAQ+ +G TPLHAAA G E C VL D A DI + G T Sbjct: 207 LIQVGADLNAQDNDGWTPLHAAAHWGQKEACAVLADNLANMDIQNLAGQT 256 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10580.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10580.1.1 >prot_P-wetherbeei_contig10580.1.1 ID=prot_P-wetherbeei_contig10580.1.1|Name=mRNA_P-wetherbeei_contig10580.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=54bp MIQPLLDAGADLNAQNRNGQTPLHAAALVGNLETCKVLLDARARPDIADCback to top mRNA from alignment at P-wetherbeei_contig10580:1427..1957+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10580.1.1 ID=mRNA_P-wetherbeei_contig10580.1.1|Name=mRNA_P-wetherbeei_contig10580.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=531bp|location=Sequence derived from alignment at P-wetherbeei_contig10580:1427..1957+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10580:1427..1957+ >mRNA_P-wetherbeei_contig10580.1.1 ID=mRNA_P-wetherbeei_contig10580.1.1|Name=mRNA_P-wetherbeei_contig10580.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=162bp|location=Sequence derived from alignment at P-wetherbeei_contig10580:1427..1957+ (Phaeothamnion wetherbeei SAG_119_79)back to top |