mRNA_P-wetherbeei_contig10555.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10555.1.1 vs. uniprot
Match: A0A836CBT5_9STRA (Mgm1-like protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CBT5_9STRA) HSP 1 Score: 75.5 bits (184), Expect = 2.430e-14 Identity = 36/60 (60.00%), Postives = 45/60 (75.00%), Query Frame = 1 Query: 22 QAYWRVSSKRVCDNVCMLLETSFLGEVPNDLEAQLLTLAQRMPDDGVSSLFKEDAALVNR 201 QAYWRV+SKRVCDN CMLLE SFL VP+ LEA LL+ AQ + +++ +EDAA+V R Sbjct: 610 QAYWRVTSKRVCDNACMLLEASFLAAVPDALEAALLSHAQTLDARALAAALQEDAAIVER 669
BLAST of mRNA_P-wetherbeei_contig10555.1.1 vs. uniprot
Match: D8LJA2_ECTSI (Mgm1 homolog, dynamin-related GTPase n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LJA2_ECTSI) HSP 1 Score: 62.0 bits (149), Expect = 1.360e-9 Identity = 29/45 (64.44%), Postives = 34/45 (75.56%), Query Frame = 1 Query: 22 QAYWRVSSKRVCDNVCMLLETSFLGEVPNDLEAQLLTLAQRMPDD 156 QAYWRV+SKRV DN CMLLETSF G+V + LE QLL L Q + + Sbjct: 610 QAYWRVTSKRVVDNACMLLETSFFGQVVDRLETQLLALTQAITQE 654
BLAST of mRNA_P-wetherbeei_contig10555.1.1 vs. uniprot
Match: A0A482SMV3_9ARCH (GED domain-containing protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482SMV3_9ARCH) HSP 1 Score: 53.1 bits (126), Expect = 1.940e-7 Identity = 23/67 (34.33%), Postives = 39/67 (58.21%), Query Frame = 1 Query: 1 MDQTKQKQAYWRVSSKRVCDNVCMLLETSFLGEVPNDLEAQLLTLAQRMPDDGVSSLFKEDAALVNR 201 M+ Q YW ++S+R+ DNVCML++ F+ V ++L+ QL + + + V + KED +V R Sbjct: 13 MEMVTMLQGYWDIASRRLVDNVCMLVDKDFVDHVLSELDTQLTVYSMGLSKNEVKDVMKEDRYIVQR 79
BLAST of mRNA_P-wetherbeei_contig10555.1.1 vs. uniprot
Match: A0A7S2E1W6_9STRA (Hypothetical protein (Fragment) n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2E1W6_9STRA) HSP 1 Score: 51.6 bits (122), Expect = 2.990e-6 Identity = 24/52 (46.15%), Postives = 34/52 (65.38%), Query Frame = 1 Query: 25 AYWRVSSKRVCDNVCMLLETSFLGEVPNDLEAQLLTLAQRMPDDGVSSLFKE 180 AYWR+SSKR+ +NV M LET + + DLE+ L++ Q +P + LFKE Sbjct: 119 AYWRLSSKRLTENVVMSLETLVIQRLATDLESMLISAVQGLPVGQLEDLFKE 170
BLAST of mRNA_P-wetherbeei_contig10555.1.1 vs. uniprot
Match: A0A7S2BUL6_9STRA (Hypothetical protein n=1 Tax=Florenciella parvula TaxID=236787 RepID=A0A7S2BUL6_9STRA) HSP 1 Score: 50.4 bits (119), Expect = 1.560e-5 Identity = 22/58 (37.93%), Postives = 39/58 (67.24%), Query Frame = 1 Query: 25 AYWRVSSKRVCDNVCMLLETSFLGEVPNDLEAQLLTLAQRMPDDGVSSLFKEDAALVN 198 AYWR+S+KR+ +NVCM +E L + +D+E++LL++ Q + V+ LF E + + + Sbjct: 24 AYWRLSAKRLTENVCMSVEAHVLTRLSDDIESELLSVMQIKTPELVAELFHEPSEVTD 81 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10555.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10555.1.1 >prot_P-wetherbeei_contig10555.1.1 ID=prot_P-wetherbeei_contig10555.1.1|Name=mRNA_P-wetherbeei_contig10555.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=68bp MDQTKQKQAYWRVSSKRVCDNVCMLLETSFLGEVPNDLEAQLLTLAQRMPback to top mRNA from alignment at P-wetherbeei_contig10555:1634..1837+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10555.1.1 ID=mRNA_P-wetherbeei_contig10555.1.1|Name=mRNA_P-wetherbeei_contig10555.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=204bp|location=Sequence derived from alignment at P-wetherbeei_contig10555:1634..1837+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10555:1634..1837+ >mRNA_P-wetherbeei_contig10555.1.1 ID=mRNA_P-wetherbeei_contig10555.1.1|Name=mRNA_P-wetherbeei_contig10555.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=204bp|location=Sequence derived from alignment at P-wetherbeei_contig10555:1634..1837+ (Phaeothamnion wetherbeei SAG_119_79)back to top |