mRNA_P-wetherbeei_contig10108.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10108.2.1 vs. uniprot
Match: A0A388L4C3_CHABU (Uncharacterized protein n=1 Tax=Chara braunii TaxID=69332 RepID=A0A388L4C3_CHABU) HSP 1 Score: 58.9 bits (141), Expect = 9.540e-7 Identity = 37/94 (39.36%), Postives = 50/94 (53.19%), Query Frame = 1 Query: 190 AKSSLGRRDAIRTAISSFGFGLV------------ALSFGLSSREAHATMPSLTVNQVKHILEGDFTDKKYLLTGDLTRDIYNPDCRFTDPTTV 435 A +S RR + A+S G G+V AL+ L + A L + ++K I+E D + +YLLTGDLT+DIY DCRF DPT V Sbjct: 159 ATTSFDRRSLMAMAVSG-GLGVVLGATLDAMTTGTALATPLETPSASGKRTHLPLEEIKSIIEHDMKEGRYLLTGDLTKDIYADDCRFEDPTNV 251
BLAST of mRNA_P-wetherbeei_contig10108.2.1 vs. uniprot
Match: A0A388L4B8_CHABU (Uncharacterized protein n=1 Tax=Chara braunii TaxID=69332 RepID=A0A388L4B8_CHABU) HSP 1 Score: 58.5 bits (140), Expect = 1.450e-6 Identity = 27/64 (42.19%), Postives = 40/64 (62.50%), Query Frame = 1 Query: 250 GLVALSFGLSSREAHATMPSLTVNQVKHILEGDFTDKKYLLTGDLTRDIYNPDCRFTDPTTVSL 441 G AL+ L + + L + ++K I+E D + KYLLTGDLT+++Y DCRF DPT V++ Sbjct: 255 GGTALATPLETPSGNGKRKHLPLEEIKSIIECDIKEGKYLLTGDLTKEVYTDDCRFEDPTNVTI 318
BLAST of mRNA_P-wetherbeei_contig10108.2.1 vs. uniprot
Match: A0A7S0X7G1_9CHLO (Hypothetical protein n=1 Tax=Mantoniella antarctica TaxID=81844 RepID=A0A7S0X7G1_9CHLO) HSP 1 Score: 54.3 bits (129), Expect = 2.170e-5 Identity = 25/55 (45.45%), Postives = 36/55 (65.45%), Query Frame = 1 Query: 265 SFGLSSREAHATMPSLTVNQVKHILEGDFTDKKYLLTGDLTRDIYNPDCRFTDPT 429 S G + A LT+ Q+K +LE D D++Y +TG+LTR+I+ +CRFTDPT Sbjct: 80 SLGGVKKVADNKTRDLTMEQIKDVLEKDLRDRQYFVTGNLTREIFADNCRFTDPT 134 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10108.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10108.2.1 >prot_P-wetherbeei_contig10108.2.1 ID=prot_P-wetherbeei_contig10108.2.1|Name=mRNA_P-wetherbeei_contig10108.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=138bp MLPRFLLLAACVAFAQGFVVTTMRVDNALRRREAVQTAARFAKSSLGRRDback to top mRNA from alignment at P-wetherbeei_contig10108:249..892- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10108.2.1 ID=mRNA_P-wetherbeei_contig10108.2.1|Name=mRNA_P-wetherbeei_contig10108.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=644bp|location=Sequence derived from alignment at P-wetherbeei_contig10108:249..892- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10108:249..892- >mRNA_P-wetherbeei_contig10108.2.1 ID=mRNA_P-wetherbeei_contig10108.2.1|Name=mRNA_P-wetherbeei_contig10108.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=414bp|location=Sequence derived from alignment at P-wetherbeei_contig10108:249..892- (Phaeothamnion wetherbeei SAG_119_79)back to top |