mRNA_P-wetherbeei_contig101.9.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig101.9.1 vs. uniprot
Match: UPI000E6F69F6 (uncharacterized protein LOC113280940 n=1 Tax=Papaver somniferum TaxID=3469 RepID=UPI000E6F69F6) HSP 1 Score: 50.1 bits (118), Expect = 6.320e-5 Identity = 19/28 (67.86%), Postives = 23/28 (82.14%), Query Frame = 2 Query: 200 KRRVDLEGKTCSCIFWDQVGIPCRHAIA 283 K RVDL K+CSC+FW +VGIPC HA+A Sbjct: 1080 KYRVDLSDKSCSCLFWQKVGIPCSHALA 1107
BLAST of mRNA_P-wetherbeei_contig101.9.1 vs. uniprot
Match: A0A3Q0EIE1_VIGRR (uncharacterized protein LOC111240565 n=1 Tax=Vigna radiata var. radiata TaxID=3916 RepID=A0A3Q0EIE1_VIGRR) HSP 1 Score: 49.7 bits (117), Expect = 7.000e-5 Identity = 19/26 (73.08%), Postives = 21/26 (80.77%), Query Frame = 2 Query: 209 VDLEGKTCSCIFWDQVGIPCRHAIAA 286 VDL TC+C FWD VGIPCRHA+AA Sbjct: 68 VDLSNHTCTCYFWDLVGIPCRHAVAA 93
BLAST of mRNA_P-wetherbeei_contig101.9.1 vs. uniprot
Match: UPI001E6900C8 (uncharacterized protein LOC123886143 n=1 Tax=Trifolium pratense TaxID=57577 RepID=UPI001E6900C8) HSP 1 Score: 49.7 bits (117), Expect = 8.290e-5 Identity = 19/27 (70.37%), Postives = 23/27 (85.19%), Query Frame = 2 Query: 206 RVDLEGKTCSCIFWDQVGIPCRHAIAA 286 +VD+ KTCSC FW+ +GIPCRHAIAA Sbjct: 314 KVDIAKKTCSCNFWELIGIPCRHAIAA 340 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig101.9.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig101.9.1 >prot_P-wetherbeei_contig101.9.1 ID=prot_P-wetherbeei_contig101.9.1|Name=mRNA_P-wetherbeei_contig101.9.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=96bp MAPLSCLKEVLEMEMRRYHERAIEVDKWRRNGFVITMRANKLYAAEEARSback to top mRNA from alignment at P-wetherbeei_contig101:9216..9909+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig101.9.1 ID=mRNA_P-wetherbeei_contig101.9.1|Name=mRNA_P-wetherbeei_contig101.9.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=694bp|location=Sequence derived from alignment at P-wetherbeei_contig101:9216..9909+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig101:9216..9909+ >mRNA_P-wetherbeei_contig101.9.1 ID=mRNA_P-wetherbeei_contig101.9.1|Name=mRNA_P-wetherbeei_contig101.9.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=288bp|location=Sequence derived from alignment at P-wetherbeei_contig101:9216..9909+ (Phaeothamnion wetherbeei SAG_119_79)back to top |