mRNA_P-wetherbeei_contig10.5.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10.5.1 vs. uniprot
Match: A0A0P1AJ68_PLAHL (Transcriptional repressor EZH1 n=1 Tax=Plasmopara halstedii TaxID=4781 RepID=A0A0P1AJ68_PLAHL) HSP 1 Score: 94.7 bits (234), Expect = 1.560e-16 Identity = 42/84 (50.00%), Postives = 53/84 (63.10%), Query Frame = 2 Query: 1397 NNMRRRTLQAEHHPCGHAGACGPATCPCVQEHGGCDKWCGCPQDCAHRFGGCRCKTSGCRTCACPCFAAGRECDSDLCTSCGAT 1648 N ++ + + E+ PC H G C P C C+ CDK C C +DC +RF GCRC CRT ACPCF A REC+ DLCT+CGA+ Sbjct: 1114 NRLKSKGVNHEYEPCNHKGVCDPTYCSCMTRDHTCDKACSCSRDCPNRFPGCRCSLGNCRTKACPCFIAARECNPDLCTTCGAS 1197
BLAST of mRNA_P-wetherbeei_contig10.5.1 vs. uniprot
Match: A0A662WSZ4_9STRA (Uncharacterized protein n=2 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662WSZ4_9STRA) HSP 1 Score: 92.0 bits (227), Expect = 1.010e-15 Identity = 41/82 (50.00%), Postives = 54/82 (65.85%), Query Frame = 2 Query: 1403 MRRRTLQAEHHPCGHAGACGPATCPCVQEHGGCDKWCGCPQDCAHRFGGCRCKTSGCRTCACPCFAAGRECDSDLCTSCGAT 1648 M+ R E+ PC H G+C A C C++ C+K CGC +DC++RF GC C+ CRT ACPC+ A RECD D+C SCGA+ Sbjct: 832 MKDRGANHEYVPCNHVGSCDSAQCSCMRRDHYCEKSCGCSRDCSNRFPGCHCEAGQCRTSACPCYFAARECDPDVCVSCGAS 913
BLAST of mRNA_P-wetherbeei_contig10.5.1 vs. uniprot
Match: A0A6G0N597_9STRA (Uncharacterized protein n=9 Tax=Phytophthora TaxID=4783 RepID=A0A6G0N597_9STRA) HSP 1 Score: 91.7 bits (226), Expect = 1.500e-15 Identity = 42/84 (50.00%), Postives = 52/84 (61.90%), Query Frame = 2 Query: 1397 NNMRRRTLQAEHHPCGHAGACGPATCPCVQEHGGCDKWCGCPQDCAHRFGGCRCKTSGCRTCACPCFAAGRECDSDLCTSCGAT 1648 N ++ + E+ PC H GAC A C C+ CDK C C +DC +RF GCRC CRT ACPCF A REC+ DLC +CGA+ Sbjct: 1158 NRLKDKGANHEYEPCNHEGACDRAGCTCMTRDHTCDKACSCSRDCPNRFPGCRCSLGNCRTKACPCFVAARECNPDLCVTCGAS 1241
BLAST of mRNA_P-wetherbeei_contig10.5.1 vs. uniprot
Match: A0A329SLM2_9STRA (Uncharacterized protein n=2 Tax=Phytophthora TaxID=4783 RepID=A0A329SLM2_9STRA) HSP 1 Score: 91.3 bits (225), Expect = 1.950e-15 Identity = 41/84 (48.81%), Postives = 52/84 (61.90%), Query Frame = 2 Query: 1397 NNMRRRTLQAEHHPCGHAGACGPATCPCVQEHGGCDKWCGCPQDCAHRFGGCRCKTSGCRTCACPCFAAGRECDSDLCTSCGAT 1648 N ++ + E+ PC H GAC C C+ CDK C C +DC +RF GC+C CRT ACPCF A REC+ DLCT+CGA+ Sbjct: 1140 NRLKDKGANHEYEPCNHEGACDSTDCSCMTRDHTCDKACSCSRDCPNRFPGCKCSLGNCRTKACPCFIAARECNPDLCTTCGAS 1223
BLAST of mRNA_P-wetherbeei_contig10.5.1 vs. uniprot
Match: F0WTA9_9STRA (Polycomblike protein putative n=1 Tax=Albugo laibachii Nc14 TaxID=890382 RepID=F0WTA9_9STRA) HSP 1 Score: 90.9 bits (224), Expect = 2.250e-15 Identity = 41/74 (55.41%), Postives = 50/74 (67.57%), Query Frame = 2 Query: 1427 EHHPCGHAGACGPATCPCVQEHGGCDKWCGCPQDCAHRFGGCRCKTSGCRTCACPCFAAGRECDSDLCTSCGAT 1648 E+ PCGH+G+C TC C+ C+K C C ++C +RF GCRC CRT ACPCFAA REC DLC +CGAT Sbjct: 773 EYEPCGHSGSCTAETCSCLNRGHTCEKACSCSKNCPNRFQGCRCSLGNCRTKACPCFAAARECLPDLCFTCGAT 846
BLAST of mRNA_P-wetherbeei_contig10.5.1 vs. uniprot
Match: D0NJ77_PHYIT (Polycomb-like protein n=1 Tax=Phytophthora infestans (strain T30-4) TaxID=403677 RepID=D0NJ77_PHYIT) HSP 1 Score: 90.5 bits (223), Expect = 3.400e-15 Identity = 41/84 (48.81%), Postives = 52/84 (61.90%), Query Frame = 2 Query: 1397 NNMRRRTLQAEHHPCGHAGACGPATCPCVQEHGGCDKWCGCPQDCAHRFGGCRCKTSGCRTCACPCFAAGRECDSDLCTSCGAT 1648 N ++ + E+ PC H GAC C C+ CDK C C +DC +RF GC+C CRT ACPCF A REC+ DLCT+CGA+ Sbjct: 1127 NRLKDKGANHEYEPCNHEGACDSNDCSCMTRDHTCDKACSCSRDCPNRFPGCKCSLGNCRTKACPCFIAARECNPDLCTTCGAS 1210
BLAST of mRNA_P-wetherbeei_contig10.5.1 vs. uniprot
Match: G4Z0T2_PHYSP (Uncharacterized protein n=1 Tax=Phytophthora sojae (strain P6497) TaxID=1094619 RepID=G4Z0T2_PHYSP) HSP 1 Score: 90.5 bits (223), Expect = 3.430e-15 Identity = 41/84 (48.81%), Postives = 51/84 (60.71%), Query Frame = 2 Query: 1397 NNMRRRTLQAEHHPCGHAGACGPATCPCVQEHGGCDKWCGCPQDCAHRFGGCRCKTSGCRTCACPCFAAGRECDSDLCTSCGAT 1648 N ++ + E+ PC H GAC C C+ CDK C C +DC +RF GCRC CRT ACPCF A REC+ DLC +CGA+ Sbjct: 1157 NRLKDKGANHEYEPCNHEGACDTTGCSCMTRDHTCDKACSCSRDCPNRFPGCRCSLGNCRTKACPCFVAARECNPDLCVTCGAS 1240
BLAST of mRNA_P-wetherbeei_contig10.5.1 vs. uniprot
Match: A0A7S3U905_9CHLO (Hypothetical protein n=1 Tax=Picocystis salinarum TaxID=88271 RepID=A0A7S3U905_9CHLO) HSP 1 Score: 88.2 bits (217), Expect = 1.310e-14 Identity = 42/76 (55.26%), Postives = 48/76 (63.16%), Query Frame = 2 Query: 1412 RTLQAEHHPCGHAGACGPATCPCVQEHGGCDKWCGCPQDCAHRFGGCRCKTSGCRTCACPCFAAGRECDSDLCTSC 1639 R + + PC +G C TC C Q C+K+C C Q C HRF GCRCK CRT ACPCFAAGRECD DLC +C Sbjct: 497 RAVLPAYKPCSCSGNCVFDTCTCAQNGNFCEKFCQCSQSCPHRFQGCRCKKGQCRTKACPCFAAGRECDPDLCHNC 572
BLAST of mRNA_P-wetherbeei_contig10.5.1 vs. uniprot
Match: G4Z4T5_PHYSP (Uncharacterized protein n=1 Tax=Phytophthora sojae (strain P6497) TaxID=1094619 RepID=G4Z4T5_PHYSP) HSP 1 Score: 88.2 bits (217), Expect = 1.520e-14 Identity = 42/82 (51.22%), Postives = 53/82 (64.63%), Query Frame = 2 Query: 1403 MRRRTLQAEHHPCGH-AGACGPATCPCVQEHGGCDKWCGCPQDCAHRFGGCRCKTSGCRTCACPCFAAGRECDSDLCTSCGA 1645 M+ R E+ PC H G+C A C C++ C+K CGC DC++RF GC C+ CRT ACPC+ A RECD D+CTSCGA Sbjct: 649 MKDRGANHEYVPCNHDGGSCDSAQCSCMRRDHYCEKACGCSPDCSNRFPGCHCEVGQCRTSACPCYFASRECDPDVCTSCGA 730
BLAST of mRNA_P-wetherbeei_contig10.5.1 vs. uniprot
Match: A0A024G2I9_9STRA (Uncharacterized protein n=1 Tax=Albugo candida TaxID=65357 RepID=A0A024G2I9_9STRA) HSP 1 Score: 87.4 bits (215), Expect = 2.700e-14 Identity = 44/86 (51.16%), Postives = 53/86 (61.63%), Query Frame = 2 Query: 1403 MRRRTLQAE----HHPCGHAGACGPATCPCVQEHGGCDKWCGCPQDCAHRFGGCRCKTSGCRTCACPCFAAGRECDSDLCTSCGAT 1648 +R RTL+ E + PC H+G C C C+ C+K C C +DC +RF GCRC CRT ACPCFAA REC DLC +CGAT Sbjct: 696 LRGRTLRTEQELEYEPCEHSGLCTVENCSCLNRGHTCEKACSCSKDCPNRFQGCRCSFGNCRTKACPCFAAARECLPDLCFTCGAT 781 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10.5.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10.5.1 >prot_P-wetherbeei_contig10.5.1 ID=prot_P-wetherbeei_contig10.5.1|Name=mRNA_P-wetherbeei_contig10.5.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=541bp MVGTVAAQPAVLPKEAARALSNVLGVSVAQVQRTWTALALRKDAAAAVVEback to top mRNA from alignment at P-wetherbeei_contig10:14585..16235+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10.5.1 ID=mRNA_P-wetherbeei_contig10.5.1|Name=mRNA_P-wetherbeei_contig10.5.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=1651bp|location=Sequence derived from alignment at P-wetherbeei_contig10:14585..16235+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10:14585..16235+ >mRNA_P-wetherbeei_contig10.5.1 ID=mRNA_P-wetherbeei_contig10.5.1|Name=mRNA_P-wetherbeei_contig10.5.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=1623bp|location=Sequence derived from alignment at P-wetherbeei_contig10:14585..16235+ (Phaeothamnion wetherbeei SAG_119_79)back to top |