Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig98631.23973.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR029058 | Alpha/Beta hydrolase fold | SUPERFAMILY | 53474 | alpha/beta-Hydrolases | coord: 71..146 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-canaliculata_contig98631.23973.1 ID=prot_P-canaliculata_contig98631.23973.1|Name=mRNA_P-canaliculata_contig98631.23973.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=167bp RVLSLLPEVDAVKIASAFAPYVDRETTPGEAANVEAAIQHTYFEMQADPT FLAAPGALSYALKGALGGKQTGQTFTFLPSGNEGTSLPVILILHDSPANL KAALWPWQPWSERGGFVFSAPTCGDGQWTQENTRAAISLALRELNAVPGA NIDDITLVTVGTAVRAI back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR029058 | AB_hydrolase |
|