Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig102145.340.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | GENE3D | 2.40.10.120 | | coord: 3..157 e-value: 4.5E-11 score: 44.5 |
None | No IPR available | PFAM | PF13365 | Trypsin_2 | coord: 18..155 e-value: 1.5E-9 score: 38.9 |
IPR009003 | Peptidase S1, PA clan | SUPERFAMILY | 50494 | Trypsin-like serine proteases | coord: 5..155 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-canaliculata_contig102145.340.1 ID=prot_P-canaliculata_contig102145.340.1|Name=mRNA_P-canaliculata_contig102145.340.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=158bp NLDNIDAVVRVRNRNGSGTGSIYGETQTTYKVVTNYHVAGRSGSTNTIDI WNNGQLVRSVQAQVKQHFFTRGTNKDISLLEIPKAALPGEQPVIPMAEYA SESVKVGDRIWQVGCDAGNWTNAERGIVLAIEDGVVFYLPNSIPGNSGGP IFSSDCSK back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR009003 | Peptidase_S1_PA |
|