Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig101224.212.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR002797 | Polysaccharide biosynthesis protein | PFAM | PF01943 | Polysacc_synt | coord: 3..104 e-value: 2.9E-7 score: 30.2 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 64..83 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 40..63 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 1..6 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 7..28 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 84..106 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 107..107 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 29..39 |
None | No IPR available | TMHMM | TMhelix | | coord: 41..63 |
None | No IPR available | TMHMM | TMhelix | | coord: 84..106 |
None | No IPR available | TMHMM | TMhelix | | coord: 9..31 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-canaliculata_contig101224.212.1 ID=prot_P-canaliculata_contig101224.212.1|Name=mRNA_P-canaliculata_contig101224.212.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=107bp SKFLKNGSWISLGFGIKSISQFLVSIFLTRILLPNTLGDYFLVANLVPFV NIIGSLGLPQTLVKIVPKLFLADNYHAISKYYTFFFKILFVSTLLISLIF ILVFSFF back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR002797 | Polysacc_synth |
|