Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig100299.84.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | | coord: 25..104 e-value: 2.8E-13 score: 52.3 |
IPR011990 | Tetratricopeptide-like helical domain superfamily | SUPERFAMILY | 48452 | TPR-like | coord: 12..104 |
None | No IPR available | PFAM | PF13432 | TPR_16 | coord: 54..104 e-value: 5.5E-9 score: 36.5 |
None | No IPR available | PANTHER | PTHR37423 | FAMILY NOT NAMED | coord: 28..103 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-canaliculata_contig100299.84.1 ID=prot_P-canaliculata_contig100299.84.1|Name=mRNA_P-canaliculata_contig100299.84.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=104bp FNSYLKASPKGPFAAEALLRLARIKGGDEAAALLKRITVEFPDSELVAPA LSELAELRVNAQDMAGAVKAYAALVEKFPSDELAQNATYGLGWARYNQGD LEGA back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR011990 | TPR-like_helical_dom_sf |
|