mRNA_P-canaliculata_contig99181.24033.1 (mRNA) Pelvetia canaliculata dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-canaliculata_contig99181.24033.1 vs. uniprot
Match: D7FK06_ECTSI (CRAL/TRIO domain containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FK06_ECTSI) HSP 1 Score: 85.1 bits (209), Expect = 1.010e-17 Identity = 37/60 (61.67%), Postives = 42/60 (70.00%), Query Frame = 1 Query: 19 WRESYGIDTILDEDLSDFDLSKVFFWCGFDRGGRPCLVYRVCEHIKPDSKKERPTAENKV 198 WR +Y +DTILDEDLS +S F+W GFDR GRPCLV+R CEH K DS PT E KV Sbjct: 79 WRTTYKLDTILDEDLSGTGVSHEFYWSGFDRDGRPCLVFRACEHRKSDSDGGSPTVEEKV 138
BLAST of mRNA_P-canaliculata_contig99181.24033.1 vs. uniprot
Match: A0A6H5KAS6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KAS6_9PHAE) HSP 1 Score: 83.6 bits (205), Expect = 3.510e-17 Identity = 36/60 (60.00%), Postives = 42/60 (70.00%), Query Frame = 1 Query: 19 WRESYGIDTILDEDLSDFDLSKVFFWCGFDRGGRPCLVYRVCEHIKPDSKKERPTAENKV 198 WR +Y +DTILDEDLS +S F+W GFDR GRPCLV+R CEH K DS PT E K+ Sbjct: 79 WRITYKLDTILDEDLSGTGVSHEFYWSGFDRDGRPCLVFRACEHRKSDSDGASPTVEEKL 138
BLAST of mRNA_P-canaliculata_contig99181.24033.1 vs. uniprot
Match: A0A7S2GJ01_9STRA (Hypothetical protein (Fragment) n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2GJ01_9STRA) HSP 1 Score: 52.8 bits (125), Expect = 2.810e-7 Identity = 19/44 (43.18%), Postives = 27/44 (61.36%), Query Frame = 1 Query: 19 WRESYGIDTILDEDLSDFDLSKVFFWCGFDRGGRPCLVYRVCEH 150 WR+++G++ +L ED SD DL + +W GFD G P LV H Sbjct: 60 WRDTFGLEQLLQEDFSDMDLRREVYWEGFDLAGHPVLVINAARH 103
BLAST of mRNA_P-canaliculata_contig99181.24033.1 vs. uniprot
Match: A0A7S4P273_GUITH (Hypothetical protein n=1 Tax=Guillardia theta TaxID=55529 RepID=A0A7S4P273_GUITH) HSP 1 Score: 48.1 bits (113), Expect = 9.740e-5 Identity = 20/58 (34.48%), Postives = 31/58 (53.45%), Query Frame = 1 Query: 19 WRESYGIDTILDEDLSDFDLSKVFFWCGFDRGGRPCLVYRVCEH------IKPDSKKE 174 WR+ Y +DTI++ED S++D + CG D+ GRP + H + P+S E Sbjct: 130 WRQEYKVDTIMEEDWSEYDKRGEMYPCGLDKDGRPTWTWHTQRHGRTINSVPPNSSPE 187 The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig99181.24033.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-canaliculata_contig99181.24033.1 >prot_P-canaliculata_contig99181.24033.1 ID=prot_P-canaliculata_contig99181.24033.1|Name=mRNA_P-canaliculata_contig99181.24033.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=68bp LGRQKIWRESYGIDTILDEDLSDFDLSKVFFWCGFDRGGRPCLVYRVCEHback to top mRNA from alignment at P-canaliculata_contig99181:152..355- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-canaliculata_contig99181.24033.1 ID=mRNA_P-canaliculata_contig99181.24033.1|Name=mRNA_P-canaliculata_contig99181.24033.1|organism=Pelvetia canaliculata dioecious|type=mRNA|length=204bp|location=Sequence derived from alignment at P-canaliculata_contig99181:152..355- (Pelvetia canaliculata dioecious)back to top Coding sequence (CDS) from alignment at P-canaliculata_contig99181:152..355- >mRNA_P-canaliculata_contig99181.24033.1 ID=mRNA_P-canaliculata_contig99181.24033.1|Name=mRNA_P-canaliculata_contig99181.24033.1|organism=Pelvetia canaliculata dioecious|type=CDS|length=408bp|location=Sequence derived from alignment at P-canaliculata_contig99181:152..355- (Pelvetia canaliculata dioecious)back to top |