mRNA_P-canaliculata_contig97641.23864.1 (mRNA) Pelvetia canaliculata dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-canaliculata_contig97641.23864.1 vs. uniprot
Match: A0A848U7Q7_9GAMM (Uncharacterized protein n=1 Tax=Granulosicoccus sp. TaxID=1943584 RepID=A0A848U7Q7_9GAMM) HSP 1 Score: 82.8 bits (203), Expect = 1.650e-16 Identity = 46/105 (43.81%), Postives = 62/105 (59.05%), Query Frame = 1 Query: 463 LVEHEDPSVRRRSVDTLSRWTRDPAHEPLIVDALDDADAGVREAAVYALAGRPAAGQDVRGELLTLIENGGEDEGVRRGAVLALNRMPLDDVERRRVQAVERELA 777 L HED +VR S+ LSRW+ D P+++DAL D + GVR++A YAL G Q V L + + G+ + R AVLAL M L D +RR + AV+RELA Sbjct: 1 LTSHEDAAVRSISLSILSRWSTDGRDTPVLLDALQDTEQGVRQSAAYALVGHEVVNQSVIDSLWAVAVDDGDTKATRSAAVLALRGMQLSDAQRRDLAAVQRELA 105 The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig97641.23864.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-canaliculata_contig97641.23864.1 >prot_P-canaliculata_contig97641.23864.1 ID=prot_P-canaliculata_contig97641.23864.1|Name=mRNA_P-canaliculata_contig97641.23864.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=263bp SVTAAAAGTATVGHDPIDPRELGREPLTDAEHAALLDRLSRDPVLLAALIback to top mRNA from alignment at P-canaliculata_contig97641:21..809- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-canaliculata_contig97641.23864.1 ID=mRNA_P-canaliculata_contig97641.23864.1|Name=mRNA_P-canaliculata_contig97641.23864.1|organism=Pelvetia canaliculata dioecious|type=mRNA|length=789bp|location=Sequence derived from alignment at P-canaliculata_contig97641:21..809- (Pelvetia canaliculata dioecious)back to top Coding sequence (CDS) from alignment at P-canaliculata_contig97641:21..809- >mRNA_P-canaliculata_contig97641.23864.1 ID=mRNA_P-canaliculata_contig97641.23864.1|Name=mRNA_P-canaliculata_contig97641.23864.1|organism=Pelvetia canaliculata dioecious|type=CDS|length=1578bp|location=Sequence derived from alignment at P-canaliculata_contig97641:21..809- (Pelvetia canaliculata dioecious)back to top |