prot_M-pyrifera_M_contig9043.20966.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig9043.20966.1 vs. uniprot
Match: A0A6H5K0I2_9PHAE (OB_NTP_bind domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K0I2_9PHAE) HSP 1 Score: 104 bits (260), Expect = 7.100e-23 Identity = 52/71 (73.24%), Postives = 61/71 (85.92%), Query Frame = 0 Query: 41 DWAQEAEDLSVDLAEFMLQTIGYDVKSLSPRHVEAMLVDSLRLTDPAEVRRILQGYPDLPEPNEVAEAPPP 111 DWAQEAE L+VDLAEFMLQ+IGYDVKS+SPRHVEA+LVD+ RLTDPAEVRRIL G+P LP ++ + P P Sbjct: 430 DWAQEAEALAVDLAEFMLQSIGYDVKSVSPRHVEALLVDTHRLTDPAEVRRILGGHPSLPGEDQQNKEPCP 500
BLAST of mRNA_M-pyrifera_M_contig9043.20966.1 vs. uniprot
Match: D8LEZ4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LEZ4_ECTSI) HSP 1 Score: 103 bits (256), Expect = 2.710e-22 Identity = 51/71 (71.83%), Postives = 60/71 (84.51%), Query Frame = 0 Query: 41 DWAQEAEDLSVDLAEFMLQTIGYDVKSLSPRHVEAMLVDSLRLTDPAEVRRILQGYPDLPEPNEVAEAPPP 111 DWAQEAE L+VDLAEFMLQ+IGYDVKS+SPRHVEA+LVD+LRL DPAEVRR+L YP LP ++ + P P Sbjct: 1391 DWAQEAEALAVDLAEFMLQSIGYDVKSVSPRHVEALLVDTLRLRDPAEVRRVLGEYPGLPGEDQQNKKPCP 1461 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig9043.20966.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig9043.20966.1 ID=prot_M-pyrifera_M_contig9043.20966.1|Name=mRNA_M-pyrifera_M_contig9043.20966.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=176bpback to top |